Recombinant Human CEACAM5, CD66e, CEA (C-6His)

Contact us
Catalog number: CM95
Price: 833 €
Supplier: acr
Product name: Recombinant Human CEACAM5, CD66e, CEA (C-6His)
Quantity: 1 mg
Other quantities: 10 µg 146€ 50 µg 303€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CEACAM5 is produced by our Mammalian expression system and the target gene encoding Lys35-Ala685 is expressed with a 6His tag at the C-terminus
Molecular Weight: 4 kD, 72
UniProt number: P06731
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDTASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD66e, CEA (C-6His), CEACAM5
Short name: CD66e, CEA (C-6His), Recombinant CEACAM5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD66e, CEA (C-6His), sapiens carcinoembryonic antigen-related cellular adhesion molecule 5, recombinant H
Alternative technique: rec
Alternative to gene target: CD66e and CEA, CEACAM5 and IDBG-53174 and ENSG00000105388 and 1048, Plasma membranes, protein homodimerization activity, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0010832 and negative regulation of myotube differentiation and biological process this GO :0016323 and basolateral plasma membrane and cellular component this GO :0031225 and anchored component of membrane and cellular component this GO :0034109 and homotypic cell-cell adhesion and biological process this GO :0034235 and GPI anchor binding and molecular function this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0071575 and integral component of external side of plasma membrane and cellular component this GO :2000811 and negative regulation of anoikis and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0034235 : GPI anchor binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity, this GO :0034235 : GPI anchor binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, carcinoembryonic antigen-related cell adhesion molecule 5
Identity: 1817
Gene: CEACAM5 | More about : CEACAM5
Long gene name: carcinoembryonic antigen related cell adhesion molecule 5
Synonyms gene: CEA
Synonyms gene name: carcinoembryonic antigen-related cell adhesion molecule 5
Synonyms: CD66e
Locus: 19q13, 2
Discovery year: 1986-01-01
GenBank acession: M17303
Entrez gene record: 1048
RefSeq identity: NM_004363
Classification: I-set domain containing Immunoglobulin like domain containing CD molecules V-set domain containing Carcinoembryonic antigen related cell adhesion molecule family
Havana BLAST/BLAT: OTTHUMG00000151061

Related Products :

CM95 Recombinant Human CEACAM5, CD66e, CEA (C-6His) 10 µg 146 € novo human
CP16 Recombinant Human CEACAM5, CD66e, CEA (C-Fc) 500 µg 1613 € novo human
MEDCLA09/1 CD66e, CEA, Clone: CEA 6.2, Mouse Monoclonal antibody-; paraffin (trypsin) 1000ul Ask price € accurate-monoclonals mouse
RP-0398H Recombinant Human CEACAM5 / CD66e Protein (His & Fc Tag) 50μg 624 € adv human
RP-0397H Recombinant Human CEACAM5 / CD66e Protein (His Tag) 50μg 624 € adv human
GENTAUR-58bde8076c015 Mouse Monoclonal [clone 36H1] (IgG1,k) to Human CEACAM5 / CD66e Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde692ce950 Mouse Monoclonal [clone 37B6] (IgG1,k) to Human CEACAM5 / CD66e Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde6ccb8e8e Mouse Monoclonal [clone CB30] (IgG1) to Human CEACAM5 / CD66e Antibody 0.025 miligrams 597 € MBS mono human
MBS244711 PAb (IgG) to Human CEACAM5 / CD66e Antibody 0.25 ml 597 € MBS Polyclonals_1 human
AM00634PU-N anti-CD66e / CEACAM5 Antibody 1 mg 572 € acr human
AM00635PU-N anti-CD66e / CEACAM5 Antibody 1 mg 572 € acr human
AM00636PU-N anti-CD66e / CEACAM5 Antibody 1 mg 572 € acr human
AM00637PU-N anti-CD66e / CEACAM5 Antibody 1 mg 572 € acr human
AM01079PU-N anti-CD66e / CEACAM5 Antibody 0,2 mg 529 € acr human
AM01079PU-T anti-CD66e / CEACAM5 Antibody 25 Вµg 311 € acr human
AM06568SU-N anti-CD66e / CEACAM5 Antibody 0,1 ml 674 € acr human
AM06569SU-N anti-CD66e / CEACAM5 Antibody 0,1 ml 674 € acr human
AM09247PU-N anti-CD66e / CEACAM5 Antibody 0,5 mg 659 € acr human
AM09248HR-N anti-CD66e / CEACAM5 Antibody 0,2 ml 703 € acr human
AM09248PU-N anti-CD66e / CEACAM5 Antibody 0,5 mg 659 € acr human
AM10076PU-N anti-CD66e / CEACAM5 Antibody 0,2 mg 616 € acr human
AM10076PU-S anti-CD66e / CEACAM5 Antibody 0,1 mg 514 € acr human
AM10076PU-T anti-CD66e / CEACAM5 Antibody 20 Вµg 282 € acr human
AM10076SU-N anti-CD66e / CEACAM5 Antibody 1 ml 471 € acr human
AM11121PU-M anti-CD66e / CEACAM5 Antibody 0,5 ml 572 € acr human
AM11121PU-N anti-CD66e / CEACAM5 Antibody 1 ml 775 € acr human
AM11121PU-S anti-CD66e / CEACAM5 Antibody 0,1 ml 326 € acr human
AM20607PU-N anti-CD66e / CEACAM5 Antibody 0,1 mg 543 € acr human
AM31404PU-N anti-CD66e / CEACAM5 Antibody 1 mg 833 € acr human
AM31405PU-N anti-CD66e / CEACAM5 Antibody 1 mg 833 € acr human