Recombinant Human LIGHT, HVEM-L, TNFSF14, CD258 (N-6His)

Contact us
Catalog number: CM84
Price: 3559 €
Supplier: abbex
Product name: Recombinant Human LIGHT, HVEM-L, TNFSF14, CD258 (N-6His)
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human LIGHT is produced by our Mammalian expression system and the target gene encoding Leu83-Val240 is expressed with a 6His tag at the N-terminus
Molecular Weight: 18, 2 kD
UniProt number: O43557
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHGLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD258 (N-6His), HVEM-L, TNFSF14, LIGHT
Short name: CD258 (N-6His), HVEM-L, TNFSF14, Recombinant LIGHT
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD258 (N-6His), HVEM-L, member 14, sapiens LIGHT, tumor necrosis factor (ligand) superfamily, recombinant H
Alternative technique: rec
Alternative to gene target: BT, CD258 and HVEML and LIGHT and LTg and TR2, Extracellular, TNFSF14 and IDBG-21748 and ENSG00000125735 and 8740, Tnfsf14 and IDBG-193745 and ENSMUSG00000005824 and 50930, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, member 14, this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008588 and release of cytoplasmic sequestered NF-kappaB and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043029 and T cell homeostasis and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, 64160 and IDBG-643941 and ENSBTAG00000012223 and 505521, tumor necrosis factor (ligand) superfamily
Identity: 11930
Gene: TNFSF14 | More about : TNFSF14
Long gene name: tumor necrosis factor superfamily member 14
Synonyms gene name: member 14 , tumor necrosis factor (ligand) superfamily
Synonyms: LIGHT LTg HVEM-L CD258
Locus: 19p13, 3
Discovery year: 1998-12-04
GenBank acession: AF036581
Entrez gene record: 8740
Pubmed identfication: 9462508
Classification: Tumor necrosis factor superfamily CD molecules
Havana BLAST/BLAT: OTTHUMG00000181835

Related Products :

CM84 Recombinant Human LIGHT, HVEM-L, TNFSF14, CD258 (N-6His) 10 µg 156 € novo human
RP-1539H Recombinant Human TNFSF14 / LIGHT / CD258 Protein (His Tag) 20μg 456 € adv human
MBS620023 TNFSF14, CT (LIGHT, TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, Herpesvirus Entry Mediator Ligand, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, TNFRSF14) Antibody 100ug 730 € MBS Polyclonals_1 human
MBS622870 TNFSF14 (LIGHT, TNF Receptor-like 2, ATAR, CD270, Herpesvirus Entry Mediator A, HVEA, Herpesvirus Entry Mediator, HVEM, TR2, Tumor Necrosis Factor Receptor Superfamily Member 14, TNFRSF14) Antibody 100ug 735 € MBS Polyclonals_1 human
C418 Recombinant Human HVEM, TNFRSF14, CD270 (C-6His) 1 mg 963 € novo human
AR20001PU-N anti-CD258 / LIGHT Antibody 15 Вµg 384 € acr human
AR20001PU-S anti-CD258 / LIGHT Antibody 3 Вµg 253 € acr human
C10109-1 anti-CD258 / LIGHT Antibody 50 Вµg 347 € acr human
C10109-2 anti-CD258 / LIGHT Antibody 0,1 mg 500 € acr human
CPA4284-100ul anti-CD258 / LIGHT Antibody 0,1 ml 442 € acr human
CPA4284-200ul anti-CD258 / LIGHT Antibody 0,2 ml 688 € acr human
CPA4284-30ul anti-CD258 / LIGHT Antibody 30 Вµl 326 € acr human
PA192 anti-CD258 / LIGHT Antibody 5 Вµg 253 € acr human
PA192X anti-CD258 / LIGHT Antibody 20 Вµg 384 € acr human
PP1211B1 anti-CD258 / LIGHT Antibody 25 Вµg 384 € acr human
PP1211B2 anti-CD258 / LIGHT Antibody 50 Вµg 543 € acr human
PP1211P1 anti-CD258 / LIGHT Antibody 50 Вµg 384 € acr human
PP1211P2 anti-CD258 / LIGHT Antibody 0,1 mg 543 € acr human
MBS422151 Goat anti-LIGHT / CD258 Antibody 100ug 370 € MBS Polyclonals_1 human
CEK1086 anti-Human CD258 ELISA Kit Antibody 96 Tests 703 € acr human
GWB-BIG0A7 Recombinant Human HVEM-Fc bulk Ask price € genways bulk human
RP-0811H Recombinant Human HVEM / TNFRSF14 Protein (His & Fc Tag) 100μg 508 € adv human
RP-0810H Recombinant Human HVEM / TNFRSF14 Protein (His Tag) 100μg 659 € adv human
abx161495 Anti-CD258 Blocking Peptide 5 mg 1485 € abbex human
GWB-36551E CD258 antibody 1 x 1 vial 267 € genways human
GENTAUR-58be3b528ed84 CD258 antibody (allophycocyanin) 100 Tests 818 € MBS mono human
GENTAUR-58be3b52e4f05 CD258 antibody (allophycocyanin) 25 Tests 437 € MBS mono human
GENTAUR-58be397cdd71a CD258 antibody (PE) 100 Tests 774 € MBS mono human
abx263144 Anti-HVEM-Fc Protein (Recombinant) 20 µg 238 € abbex human
abx260770 Anti-HVEM Protein (Recombinant) 1 mg 3559 € abbex human