| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human LIGHT is produced by our Mammalian expression system and the target gene encoding Leu83-Val240 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
18, 2 kD |
| UniProt number: |
O43557 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HHHHHHGLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD258 (N-6His), HVEM-L, TNFSF14, LIGHT |
| Short name: |
CD258 (N-6His), HVEM-L, TNFSF14, Recombinant LIGHT |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD258 (N-6His), HVEM-L, member 14, sapiens LIGHT, tumor necrosis factor (ligand) superfamily, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
BT, CD258 and HVEML and LIGHT and LTg and TR2, Extracellular, TNFSF14 and IDBG-21748 and ENSG00000125735 and 8740, Tnfsf14 and IDBG-193745 and ENSMUSG00000005824 and 50930, cysteine-type endopeptidase inhibitor activity involved in apoptotic process, member 14, this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005164 and tumor necrosis factor receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006915 and apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0007165 and signal transduction and biological process this GO :0008588 and release of cytoplasmic sequestered NF-kappaB and biological process this GO :0010820 and positive regulation of T cell chemotaxis and biological process this GO :0016020 and membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0031295 and T cell costimulation and biological process this GO :0042098 and T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043029 and T cell homeostasis and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0071260 and cellular response to mechanical stimulus and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005164 : tumor necrosis factor receptor binding and also this GO :0005515 : protein binding and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0005125 : cytokine activity, this GO :0005164 : tumor necrosis factor receptor binding, this GO :0005515 : protein binding, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, 64160 and IDBG-643941 and ENSBTAG00000012223 and 505521, tumor necrosis factor (ligand) superfamily |
| Identity: |
11930 |
| Gene: |
TNFSF14 |
More about : TNFSF14 |
| Long gene name: |
tumor necrosis factor superfamily member 14 |
| Synonyms gene name: |
member 14 , tumor necrosis factor (ligand) superfamily |
| Synonyms: |
LIGHT LTg HVEM-L CD258 |
| Locus: |
19p13, 3 |
| Discovery year: |
1998-12-04 |
| GenBank acession: |
AF036581 |
| Entrez gene record: |
8740 |
| Pubmed identfication: |
9462508 |
| Classification: |
Tumor necrosis factor superfamily CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000181835 |