Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)

Contact us
Catalog number: CM68
Price: 1846 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 50 µg 369€
Related search:

More details :

Reacts with: Dechloromonas aromatica (strain RCB) Chlorite dismutase
Source: proteins, Recombinants or rec
Description: Recombinant Dechloromonas aromatica (strain RCB) Chlorite dismutase Chlorite dismutase is produced by our E, coli expression system and the target gene encoding Met35-Asp282 is expressed with a 6His tag at the N-terminus
Molecular Weight: 3 kD, 31
UniProt number: Q47CX0
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 0, pH7, 2 um filtered solution of phosphate buffered saline, 4, 5 mM EDTA, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMENLYFQGMQPMQSMKIERGTILTQPGVFGVFTMFKLRPDWNKVPVAERKGAAEEVKKLIEKHKDNVLVDLYLTRGLETNSDFFFRINAYDLAKAQTFMREFRSTTVGKNADVFETLVGVTKPLNYISKDKSPGLNAGLSSATYSGPAPRYVIVIPVKKNAEWWNMSPEERLKEMEVHTTPTLAYLVNVKRKLYHSTGLDDTDFITYFETDDLTAFNNLMLSLAQVKENKFHVRWGSPTTLGTIHSPEDVIKALAD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)
Short name: Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His)
Alternative technique: rec

Related Products :

CM68 Recombinant Dechloromonas aromatica (Strain RCB) Chlorite Dismutase (N-6His) 10 µg 156 € novo human
AE29984PI-48 ELISA test for Pig Collagen-like Bioprotein I (RCB I) 1x plate of 48 wells 402 € abebio pig
ICAS321 Ion chromatography Anion standard Chlorite 1000 ppm in pure water 100ml 135 € reageco human
ICAS321-50ml Ion chromatography Anion standard Chlorite 1000 ppm in pure water 50ml 133 € reageco human
AE29984PI-96 Pig Collagen-like Bioprotein I (RCB I) ELISA Kit 1x plate of 96 wells 671 € abebio pig
GENTAUR-58bdaf53c4088 Dechloromonas aromatica 3-demethylubiquinone-9 3-methyltransferase (ubiG) 100ug 1696 € MBS Recombinant Proteins human
GENTAUR-58bdaf544b559 Dechloromonas aromatica 3-demethylubiquinone-9 3-methyltransferase (ubiG) 1000ug 1696 € MBS Recombinant Proteins human
GENTAUR-58bdaf54a5730 Dechloromonas aromatica 3-demethylubiquinone-9 3-methyltransferase (ubiG) 100ug 2210 € MBS Recombinant Proteins human
GENTAUR-58bdaf55162b0 Dechloromonas aromatica 3-demethylubiquinone-9 3-methyltransferase (ubiG) 1000ug 2210 € MBS Recombinant Proteins human
GENTAUR-58bd63dc25f46 Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC) 100ug 2304 € MBS Recombinant Proteins human
GENTAUR-58bd63dc6b47a Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC) 1000ug 2304 € MBS Recombinant Proteins human
GENTAUR-58bd63dcb3881 Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC) 100ug 2813 € MBS Recombinant Proteins human
GENTAUR-58bd63dd101e0 Dechloromonas aromatica 3-isopropylmalate dehydratase large subunit (leuC) 1000ug 2813 € MBS Recombinant Proteins human
GENTAUR-58bd738039b1e Dechloromonas aromatica 3-isopropylmalate dehydratase small subunit (leuD) 100ug 1647 € MBS Recombinant Proteins human
GENTAUR-58bd738089a23 Dechloromonas aromatica 3-isopropylmalate dehydratase small subunit (leuD) 1000ug 1647 € MBS Recombinant Proteins human
GENTAUR-58bd7380d26df Dechloromonas aromatica 3-isopropylmalate dehydratase small subunit (leuD) 100ug 2161 € MBS Recombinant Proteins human
GENTAUR-58bd73812f1a1 Dechloromonas aromatica 3-isopropylmalate dehydratase small subunit (leuD) 1000ug 2161 € MBS Recombinant Proteins human
GENTAUR-58bd5b439ba1e Dechloromonas aromatica 50S ribosomal protein L15 (rplO) 100ug 1481 € MBS Recombinant Proteins human
GENTAUR-58bd5b43e5ea7 Dechloromonas aromatica 50S ribosomal protein L15 (rplO) 1000ug 1481 € MBS Recombinant Proteins human
GENTAUR-58bd5b442e358 Dechloromonas aromatica 50S ribosomal protein L15 (rplO) 100ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bd5b4478f50 Dechloromonas aromatica 50S ribosomal protein L15 (rplO) 1000ug 1984 € MBS Recombinant Proteins human
GENTAUR-58bd8c9a3f778 Dechloromonas aromatica 50S ribosomal protein L18 (rplR) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd8c9a8d67b Dechloromonas aromatica 50S ribosomal protein L18 (rplR) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd8c9b06d8a Dechloromonas aromatica 50S ribosomal protein L18 (rplR) 100ug 1917 € MBS Recombinant Proteins human
GENTAUR-58bd8c9b6b7d4 Dechloromonas aromatica 50S ribosomal protein L18 (rplR) 1000ug 1917 € MBS Recombinant Proteins human
GENTAUR-58bd5e16b4f8c Dechloromonas aromatica 50S ribosomal protein L28 (rpmB) 100ug 1310 € MBS Recombinant Proteins human
GENTAUR-58bd5e170d7bf Dechloromonas aromatica 50S ribosomal protein L28 (rpmB) 1000ug 1310 € MBS Recombinant Proteins human
GENTAUR-58bd5e17468f0 Dechloromonas aromatica 50S ribosomal protein L28 (rpmB) 100ug 1812 € MBS Recombinant Proteins human
GENTAUR-58bd5e1791711 Dechloromonas aromatica 50S ribosomal protein L28 (rpmB) 1000ug 1812 € MBS Recombinant Proteins human
GENTAUR-58bd7a9e15cd7 Dechloromonas aromatica Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta (accD) 100ug 1846 € MBS Recombinant Proteins human