Recombinant Human EpCAM, TROP1, CD326 (C-Fc)

Contact us
Catalog number: CM50
Price: 572 €
Supplier: acr
Product name: Recombinant Human EpCAM, TROP1, CD326 (C-Fc)
Quantity: 1,0 ml
Other quantities: 10 µg 126€ 50 µg 232€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a Fc tag at the C-terminus
Molecular Weight: 5 kD, 54
UniProt number: P16422
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD326 (C-Fc), TROP1, EpCAM
Short name: CD326 (C-Fc), TROP1, Recombinant EpCAM
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD326 (C-fragment c), TROP1, sapiens epithelial cellular adhesion molecule, recombinant H
Alternative technique: rec
Identity: 11529
Gene: EPCAM | More about : EPCAM
Long gene name: epithelial cell adhesion molecule
Synonyms gene: M4S1 MIC18 TACSTD1
Synonyms gene name: antigen identified by monoclonal antibody AUA1 tumor-associated calcium signal transducer 1
Synonyms: Ly74 TROP1 GA733-2 EGP34 EGP40 EGP-2 KSA CD326 Ep-CAM HEA125 KS1/4 MK-1 MH99 MOC31 323/A3 17-1A TACST-1 CO-17A ESA
Locus: 2p21
Discovery year: 1995-10-02
GenBank acession: M33011
Entrez gene record: 4072
Pubmed identfication: 8382772 11306819
Classification: CD molecules
Havana BLAST/BLAT: OTTHUMG00000128853
Locus Specific Databases: Colon cancer gene variant databases LRG_215

Related Products :

C339 Recombinant Human EpCAM, TROP1, CD326 (C-6His) 500 µg 1613 € novo human
CM50 Recombinant Human EpCAM, TROP1, CD326 (C-Fc) 1 mg 1877 € novo human
MBS423211 Goat anti-EPCAM / TROP1 (aa167-179) Antibody 100ug 370 € MBS Polyclonals_1 human
AR50669PU-N anti-CD326 / EPCAM / TACSTD1 (24-265, His-tag) Antibody 0,5 mg 1109 € acr human
AR50669PU-S anti-CD326 / EPCAM / TACSTD1 (24-265, His-tag) Antibody 0,1 mg 485 € acr human
AM06447SU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 630 € acr human
AM10033FC-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,2 mg 616 € acr human
AM10033FC-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 485 € acr human
AM10033PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 1 ml 572 € acr human
AM10033PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 442 € acr human
AM11133PU-M anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 572 € acr human
AM11133PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 1 ml 775 € acr human
AM11133PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 326 € acr human
AM26013PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 355 € acr human
AM32818SU-L anti-CD326 / EPCAM / TACSTD1 Antibody 1,0 ml 572 € acr human
AM32818SU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 471 € acr human
AM32818SU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 268 € acr human
AM32819SU-L anti-CD326 / EPCAM / TACSTD1 Antibody 1,0 ml 572 € acr human
AM32819SU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,5 ml 471 € acr human
AM32819SU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 268 € acr human
AM33039PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 543 € acr human
AM33194PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 1 ml 1413 € acr human
AM33194PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 ml 601 € acr human
AM33243AC-S anti-CD326 / EPCAM / TACSTD1 Antibody 100 Tests 471 € acr human
AM33243PU-N anti-CD326 / EPCAM / TACSTD1 Antibody 0,2 mg 616 € acr human
AM33243PU-S anti-CD326 / EPCAM / TACSTD1 Antibody 0,1 mg 514 € acr human
AM33243PU-T anti-CD326 / EPCAM / TACSTD1 Antibody 20 Вµg 282 € acr human
AM33243RP-N anti-CD326 / EPCAM / TACSTD1 Antibody 100 Tests 514 € acr human
AM33243RP-S anti-CD326 / EPCAM / TACSTD1 Antibody 25 Tests 326 € acr human
AM33247SU-L anti-CD326 / EPCAM / TACSTD1 Antibody 1,0 ml 572 € acr human