| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human EpCAM is produced by our Mammalian expression system and the target gene encoding Gln24-Lys265 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
5 kD, 54 |
| UniProt number: |
P16422 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD326 (C-Fc), TROP1, EpCAM |
| Short name: |
CD326 (C-Fc), TROP1, Recombinant EpCAM |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD326 (C-fragment c), TROP1, sapiens epithelial cellular adhesion molecule, recombinant H |
| Alternative technique: |
rec |
| Identity: |
11529 |
| Gene: |
EPCAM |
More about : EPCAM |
| Long gene name: |
epithelial cell adhesion molecule |
| Synonyms gene: |
M4S1 MIC18 TACSTD1 |
| Synonyms gene name: |
antigen identified by monoclonal antibody AUA1 tumor-associated calcium signal transducer 1 |
| Synonyms: |
Ly74 TROP1 GA733-2 EGP34 EGP40 EGP-2 KSA CD326 Ep-CAM HEA125 KS1/4 MK-1 MH99 MOC31 323/A3 17-1A TACST-1 CO-17A ESA |
| Locus: |
2p21 |
| Discovery year: |
1995-10-02 |
| GenBank acession: |
M33011 |
| Entrez gene record: |
4072 |
| Pubmed identfication: |
8382772 11306819 |
| Classification: |
CD molecules |
| Havana BLAST/BLAT: |
OTTHUMG00000128853 |
| Locus Specific Databases: |
Colon cancer gene variant databases LRG_215 |