Recombinant Mouse Cathepsin S, CTSS (C-6His)

Contact us
Catalog number: CM37
Price: 597 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Mouse Cathepsin S, CTSS (C-6His)
Quantity: 50ug
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Cathepsin S is produced by our Mammalian expression system and the target gene encoding Val18-Ile340 is expressed with a 6His tag at the C-terminus
Molecular Weight: 37, 5 kD
UniProt number: O70370
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: CTSS | More about : CTSS
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: CTSS (C-6His), Cathepsin S
Short name: CTSS (C-6His), Recombinant Mouse Cathepsin S
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Mouses, Mouse
Alternative name: cathepsin S (C-6His), recombinant Mouse Cathepsin S
Alternative technique: rec
Alternative to gene target: CTSS and IDBG-102189 and ENSG00000163131 and 1520, CTSS and IDBG-633332 and ENSBTAG00000017135 and 327711, Ctss and IDBG-172850 and ENSMUSG00000038642 and 13040, Extracellular, TAP-independent and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0006955 and immune response and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0016020 and membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0034769 and basement membrane disassembly and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0043202 and lysosomal lumen and cellular component this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043236 and laminin binding and molecular function this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, proteoglycan binding, this GO :0001968 and fibronectin binding and molecular function this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002480 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043236 : laminin binding and also this GO :0043394 : proteoglycan binding, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043236 : laminin binding, this GO :0043394 : proteoglycan binding, cathepsin S
Identity: 2545
Long gene name: cathepsin S
Locus: 1q21, 3
Discovery year: 1992-07-09
GenBank acession: M90696
Entrez gene record: 1520
Pubmed identfication: 1373132
RefSeq identity: NM_004079
Classification: Cathepsins
Havana BLAST/BLAT: OTTHUMG00000035010

Related Products :

CM37 Recombinant Mouse Cathepsin S, CTSS (C-6His) 50 µg 496 € novo mouse
C402 Recombinant Human Cathepsin S, CTSS (C-6His) 500 µg 1613 € novo human
MBS624515 CTSH, NT (Cathepsin H, Cathepsin H Mini Chain, Cathepsin H Heavy Chain, Cathepsin H Light Chain, CPSB) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS624507 CTSK (ID R222) (Cathepsin K, Cathepsin O, Cathepsin X, Cathepsin O2, CTSO2, CTSO) Antibody 200ul 603 € MBS Polyclonals_1 human
RP-1081M Recombinant Mouse Cathepsin S / CTSS Protein (His Tag) 10μg 624 € adv mouse
CTHS24-N-10 Recombinant (HEK) Human Cathepsin S (CTSS) protein (>95%, his-tag low endotoxins) 10 μg 405 € adi human
RP-0226H Recombinant Human Cathepsin S / CTSS Protein (His Tag) 10μg 624 € adv human
abx576043 Anti-Mouse Cathepsin S (CTSS) ELISA Kit 96 tests 775 € abbex mouse
GENTAUR-58bcfb9993a7a Mouse Cathepsin S (Ctss) 100ug 1658 € MBS Recombinant Proteins mouse
GENTAUR-58bcfb99c9aad Mouse Cathepsin S (Ctss) 1000ug 1658 € MBS Recombinant Proteins mouse
GENTAUR-58bcfb9a203a5 Mouse Cathepsin S (Ctss) 100ug 2172 € MBS Recombinant Proteins mouse
GENTAUR-58bcfb9a6af69 Mouse Cathepsin S (Ctss) 1000ug 2172 € MBS Recombinant Proteins mouse
DL-CTSS-Mu Mouse Cathepsin S CTSS ELISA Kit 96T 904 € DL elisas mouse
GENTAUR-58bdc5ac3462b Anti- Cathepsin S (CTSS) Antibody 50ug 365 € MBS Polyclonals human
GENTAUR-58bdc5acab49d Anti- Cathepsin S (CTSS) Antibody 100ug 470 € MBS Polyclonals human
GENTAUR-58bdc70b34152 Anti- Cathepsin S (CTSS) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdca2a85c2f Anti- Cathepsin S (CTSS) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdca2ae57d9 Anti- Cathepsin S (CTSS) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdd2e694179 Anti- Cathepsin S (CTSS) Antibody 100ug 509 € MBS Polyclonals human
GENTAUR-58bdd5ce844ba Anti- Cathepsin S (CTSS) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdd67ab0931 Anti- Cathepsin S (CTSS) Antibody 100ug 542 € MBS Polyclonals human
abx570412 Anti-Human Cathepsin S (CTSS) ELISA Kit 96 tests 760 € abbex human
abx573400 Anti-Rat Cathepsin S (CTSS) ELISA Kit 96 tests 804 € abbex rat
EKU03040 Cathepsin S (CTSS) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
EKU03041 Cathepsin S (CTSS) ELISA kit 1 plate of 96 wells 804 € Biomatik ELISA kits human
EKU03042 Cathepsin S (CTSS) ELISA kit 1 plate of 96 wells 846 € Biomatik ELISA kits human
GWB-22CC94 Cathepsin S (CTSS) Goat antibody to or anti-Human Polyclonal antibody 1 x 1 vial 602 € genways human
MBS242108 Goat Polyclonal to Human CTSS / Cathepsin S Antibody 50ug 597 € MBS Polyclonals_1 human
DL-CTSS-Hu Human Cathepsin S CTSS ELISA Kit 96T 869 € DL elisas human
MBS248530 PAb (IgG) to Human CTSS / Cathepsin S Antibody 50ug 597 € MBS Polyclonals_1 human