| Reacts with: |
Mouse |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Mouse Cathepsin S is produced by our Mammalian expression system and the target gene encoding Val18-Ile340 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
37, 5 kD |
| UniProt number: |
O70370 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VCSVAMEQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEILCRMGALRIPRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKATDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEIVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
CTSS |
More about : CTSS |
| Test: |
A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or |
| Latin name: |
Mus musculus |
| Group: |
recombinants |
| Gene target: |
CTSS (C-6His), Cathepsin S |
| Short name: |
CTSS (C-6His), Recombinant Mouse Cathepsin S |
| Technique: |
E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Mouses, Mouse |
| Alternative name: |
cathepsin S (C-6His), recombinant Mouse Cathepsin S |
| Alternative technique: |
rec |
| Alternative to gene target: |
CTSS and IDBG-102189 and ENSG00000163131 and 1520, CTSS and IDBG-633332 and ENSBTAG00000017135 and 327711, Ctss and IDBG-172850 and ENSMUSG00000038642 and 13040, Extracellular, TAP-independent and biological process this GO :0004197 and cysteine-type endopeptidase activity and molecular function this GO :0005518 and collagen binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005764 and lysosome and cellular component this GO :0006508 and proteolysis and biological process this GO :0006955 and immune response and biological process this GO :0008233 and peptidase activity and molecular function this GO :0008234 and cysteine-type peptidase activity and molecular function this GO :0016020 and membrane and cellular component this GO :0019882 and antigen processing and presentation and biological process this GO :0019886 and antigen processing and presentation of exogenous peptide antigen via MHC class II and biological process this GO :0022617 and extracellular matrix disassembly and biological process this GO :0030198 and extracellular matrix organization and biological process this GO :0030574 and collagen catabolic process and biological process this GO :0034769 and basement membrane disassembly and biological process this GO :0036021 and endolysosome lumen and cellular component this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0043202 and lysosomal lumen and cellular component this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043236 and laminin binding and molecular function this GO :0043394 and proteoglycan binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0050729 and positive regulation of inflammatory response and biological process this GO :0051603 and proteolysis involved in cellular protein catabolic process and biological process this GO :0097067 and cellular response to thyroid hormone stimulus and biological process, proteoglycan binding, this GO :0001968 and fibronectin binding and molecular function this GO :0002224 and toll-like receptor signaling pathway and biological process this GO :0002250 and adaptive immune response and biological process this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002480 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0004197 : cysteine-type endopeptidase activity and also this GO :0005518 : collagen binding and also this GO :0008233 : peptidase activity and also this GO :0008234 : cysteine-type peptidase activity and also this GO :0043236 : laminin binding and also this GO :0043394 : proteoglycan binding, this GO :0004197 : cysteine-type endopeptidase activity, this GO :0005518 : collagen binding, this GO :0008233 : peptidase activity, this GO :0008234 : cysteine-type peptidase activity, this GO :0043236 : laminin binding, this GO :0043394 : proteoglycan binding, cathepsin S |
| Identity: |
2545 |
| Long gene name: |
cathepsin S |
| Locus: |
1q21, 3 |
| Discovery year: |
1992-07-09 |
| GenBank acession: |
M90696 |
| Entrez gene record: |
1520 |
| Pubmed identfication: |
1373132 |
| RefSeq identity: |
NM_004079 |
| Classification: |
Cathepsins |
| Havana BLAST/BLAT: |
OTTHUMG00000035010 |