Recombinant E. coli Tryptophan Synthase α Chain, Trp A

Contact us
Catalog number: CM30
Price: 260 €
Supplier: adi
Product name: Recombinant E. coli Tryptophan Synthase α Chain, Trp A
Quantity: 1 mg
Other quantities: 1 mg 2283€ 10 µg 156€ 50 µg 369€
Related search:

More details :

Reacts with: E, coli
Source: proteins, Recombinants or rec
Description: Recombinant E, coli Tryptophan synthase alpha chain is produced by our E, coli expression system and the target gene encoding Met1-Ser268 is expressed
Molecular Weight: 28, 7 kD
UniProt number: P0A877
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MERYESLFAQLKERKEGAFVPFVTLGDPGIEQSLKIIDTLIEAGADALELGIPFSDPLADGPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEKVGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRAGVTGAENRAALPLNHLVAKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKIIEQHINEPEKMLAALKVFVQPMKAATRS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: Chain, Trp A, Tryptophan Synthase &alpha
Short name: Chain, Trp A, coli Tryptophan Synthase &alpha, Recombinant E
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Host: Escherichia coli
Species: coli, E
Alternative name: L-tryptophan A, coli Tryptophan Synthase &alpha, epitope, recombinant E
Alternative technique: rec

Related Products :

SP-55209-1 Pep-1 [H-Lus-Glu-Thr-Trp-Trp-Glu-Thr-Trp-Trp-Thr-Glu-Trp-Ser-Gln-Pro-Lys-Lys-Lys-Arg-Lys-Val-OH; MW: 2848.29] 1 mg 189 € adi human
SP-55134-1 Indolicidin [H-Ile-Leu-Pro-Trp-Lys-Trp-Pro0Trp-Trp-Pro-Trp-Arg-Arg-NH2; MW: 1906.33] 0,5 mg 224 € adi human
MBS621565 Tryptophan Hydroxylase (TPH, TPRH, MGC119994, Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase, Tryptophan 5-monooxygenase 1, Tryptophan Hydroxylase 1, TPH 1, TPH1) 100ul 713 € MBS Polyclonals_1 human
SP-89802-5 [D-Arg1,D-Trp5,7,9,Leu11]-Substance P [D-Arg-Pro-Lys-Pro-D-Trp-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2; MW: 1555.91] 5 mg 405 € adi human
SP-89814-5 [D-Glu5,D-Trp7,9,10]-Substance P (5-11) [D-Glu-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2; MW: 1111.30] 5 mg 478 € adi human
SP-89806-1 [D-Pro4,D-Trp7,9,10]-Substance P (4-11) [D-Pro-Gln-Gln-D-Trp-Phe-D-Trp-D-Trp-Met-NH2; MW: 1207.43] 1 mg 188 € adi human
SP-89808-1 [D-Pro4,D-Trp7,9,10,Val8]-Substance P (4-11) [D-Pro-Gln-Gln-D-Trp-Val-D-Trp-D-Trp-Met-NH2; MW: 1159.39] 1 mg 188 € adi human
SP-89805-1 [D-Trp2,7,9]-Substance P [Arg-D-Trp-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Met-NH2; MW: 1604.96] 1 mg 188 € adi human
SP-101037-1 Galanin (1-13)-Spantide I (AA: Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-D-Arg-Pro-Lys-Pro-Gln-Gln-D-Trp-Phe-D-Trp-Leu-Leu-NH2) (MW: 2828.34) 1 mg 333 € adi human
SP-100807-5 HJ Inhibitor Peptide 2 (AA: Lys-Trp-Trp-Cys-Arg-Trp) (MW: 964.16) 5 mg 188 € adi human
SP-88430-1 RES-701-1 (AA: Gly-Asn-Trp-His-Gly-Thr-Ala-Pro-Asp-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp) (MW: 2061.22) 1 mg 188 € adi human
SP-88431-1 RES-701-3 (AA: Gly-Asn-Trp-His-Gly-Thr-Ser-Pro-Asp-Trp-Phe-Phe-Asn-Tyr-Tyr-Trp) (MW: 2077.22) 1 mg 188 € adi human
CM30 Recombinant E. coli Tryptophan Synthase α Chain, Trp A 500 µg 1613 € novo human
MBS621997 Tryptophan Hydroxylase 2, phosphorylated (Ser19) (Tryptophan 5-hydroxylase 2, TPH 2, TPH2, FLJ37295, HGNC:20692, Neuronal Tryptophan Hydroxylase, NTPH, Tryptophan 5-monooxygenase 2) Antibody 100ul 807 € MBS Polyclonals_1 human
MBS619965 Tryptophan Hydroxylase 2 (Tryptophan 5-hydroxylase 2, TPH 2, TPH2, FLJ37295, HGNC:20692, Neuronal Tryptophan Hydroxylase, NTPH, Tryptophan 5-monooxygenase 2) Antibody 100ug 641 € MBS Polyclonals_1 human
MBS623315 Tryptophan Hydroxylase, phosphorylated (Ser260) (TPH, TPRH, MGC119994, Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase, Tryptophan 5-monooxygenase 1, Tryptophan Hydroxylase 1, TPH 1, TPH1) 100ul 713 € MBS Polyclonals_1 human
MBS619840 Tryptophan Hydroxylase, phosphorylated (Ser58) (TPH, TPRH, MGC119994, Tryptophan 5-hydroxylase 1, Tryptophan 5-monooxygenase, Tryptophan 5-monooxygenase 1, Tryptophan Hydroxylase 1, TPH 1, TPH1) 100ul 713 € MBS Polyclonals_1 human
SP-86723-5 Tryptophan Motif Peptide (AA: Gly-Gly-Trp-Ser-His-Trp-NH2) (MW: 727.79) 5 mg 188 € adi human
CM31 Recombinant E. coli Tryptophan Synthase β Chain, Trp B 1 mg 2283 € novo human
MBS619394 Spectrin, alpha (Spectrin alpha Chain, Spectrin alpha Chain Brain, Spectrin Non-erythroid alpha Chain, Alpha Fodrin, Alpha II Spectrin, FLJ44613, Fodrin alpha Chain, Non-erythrocytic Spectrin alpha, Spectrin alpha Non-erythrocytic 1, SPTAN1, SPTA2) Antibody 100ul 785 € MBS Polyclonals_1 human
SP-88495-5 α-Mating Factor (1-6) [Trp-His-Trp-Leu-Gln-Leu (MW: 882.04)] 5 mg 188 € adi human
MBS622864 Tubulin, alpha, Detyrosinated (Alpha Tubulin, Tubulin alpha Ubiquitous, H2-Alpha, K-alpha-1, TUBA3, Tubulin alpha 1 Chain, TUBA1, TUBA1A, Tubulin K alpha 1) Antibody 50ug 1089 € MBS Polyclonals_1 human
SP-86867-1 abIII probe [Ser-Ser-Trp-Asp-Met-His-Gln-Phe-Phe-Trp-Glu-Gly-Val-Ser-Arg (MW: 1899.09)] 1 mg 188 € adi human
SP-88426-5 Ac-[DTrp16] Endothelin-1 (16-21), human [Ac-D-Trp-Leu-Asp-Ile-Ile-Trp (MW: 887.03)] 5 mg 333 € adi human
SP-55256-1 Antagonist G [H-Ard-D-Trp-N-Me-Phe-D-Trp-Ley-Met-NH2; MW: 951.2] 0,5 mg 260 € adi human
SP-88228-1 BAM - 18P (AA: Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln) (MW: 2334.69) 1 mg 188 € adi human
SP-55216-1 BAM-22P [H-Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-OH; MW; 2839.28] 1 mg 317 € adi human
SP-88226-1 BAM 3200 Peptide E (AA: Tyr-Gly-Gly-Phe-Met-Arg-Arg-Val-Gly-Arg-Pro-Glu-Trp-Trp-Met-Asp-Tyr-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu) (MW: 3156.67) 1 mg 260 € adi human
SP-86865-5 β I probe [Ser-Arg-Glu-Trp-Glu-Asp-Gly-Phe-Gly-Gly-Arg-Trp-Leu-Ser-Arg (MW: 1873.99)] 5 mg 333 € adi human
SP-88140-1 Big Gastrin - 1, human (AA: Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2) (MW: 3849.30) 1 mg 260 € adi human