| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human CTGF is produced by our Mammalian expression system and the target gene encoding Glu27-Ala180 is expressed |
| Molecular Weight: |
16, 3 kD |
| UniProt number: |
P29279 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CCN2, CTGF, Connective Tissue Growth Factor |
| Short name: |
CCN2, CTGF, Recombinant Connective Tissue Growth Factor |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CCN2, connective tissue growth factor, sapiens Connective Tissue Growth Factor, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CCN2 and HCS24 and IGFBP8 and NOV2, CTGF and IDBG-633353 and ENSBTAG00000006367 and 281103, CTGF and IDBG-96631 and ENSG00000118523 and 1490, Ctgf and IDBG-138628 and ENSMUSG00000019997 and 14219, Extracellular, heparin binding, this GO :0001502 and cartilage condensation and biological process this GO :0001503 and ossification and biological process this GO :0001525 and angiogenesis and biological process this GO :0001558 and regulation of cell growth and biological process this GO :0001894 and tissue homeostasis and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001968 and fibronectin binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005520 and insulin-like growth factor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005801 and cis- this GO lgi network and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005938 and cell cortex and cellular component this GO :0006260 and DNA replication and biological process this GO :0006367 and transcription initiation from RNA polymerase II promoter and biological process this GO :0007160 and cell-matrix adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0008544 and epidermis development and biological process this GO :0009611 and response to wounding and biological process this GO :0009749 and response to glucose and biological process this GO :0010260 and organ senescence and biological process this GO :0010467 and gene expression and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016477 and cell migration and biological process this GO :0030154 and cell differentiation and biological process this GO :0030324 and lung development and biological process this GO :0032330 and regulation of chondrocyte differentiation and biological process this GO :0032355 and response to estradiol and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034059 and response to anoxia and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0035988 and chondrocyte proliferation and biological process this GO :0043200 and response to amino acid and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050867 and positive regulation of cell activation and biological process this GO :0051385 and response to mineralocorticoid and biological process this GO :0051496 and positive regulation of stress fiber assembly and biological process this GO :0060401 and cytosolic calcium ion transport and biological process this GO :0060452 and positive regulation of cardiac muscle contraction and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0061448 and connective tissue development and biological process this GO :0070278 and extracellular matrix constituent secretion and biological process this GO :0070318 and positive regulation of G0 to G1 transition and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070542 and response to fatty acid and biological process this GO :0072593 and reactive oxygen species metabolic process and biological process, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0005178 : integrin binding and also this GO :0005515 : protein binding and also this GO :0005520 : insulin-like growth factor binding and also this GO :0008083 : growth factor activity and also this GO :0008201 : heparin binding, this GO :0005178 : integrin binding, this GO :0005515 : protein binding, this GO :0005520 : insulin-like growth factor binding, this GO :0008083 : growth factor activity, this GO :0008201 : heparin binding, connective tissue growth factor |
| Identity: |
2500 |
| Gene: |
CTGF |
More about : CTGF |
| Long gene name: |
connective tissue growth factor |
| Synonyms: |
IGFBP8 CCN2 |
| Locus: |
6q23, 2 |
| Discovery year: |
1992-12-01 |
| GenBank acession: |
X78947 |
| Entrez gene record: |
1490 |
| Pubmed identfication: |
1654338 |
| RefSeq identity: |
NM_001901 |
| Classification: |
CYR61/CTGF/NOV matricellular proteins |
| Havana BLAST/BLAT: |
OTTHUMG00000015573 |