Recombinant Human Connective Tissue Growth Factor, CTGF, CCN2

Contact us
Catalog number: CM22
Price: 442 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Connective Tissue Growth Factor, CTGF, CCN2
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human CTGF is produced by our Mammalian expression system and the target gene encoding Glu27-Ala180 is expressed
Molecular Weight: 16, 3 kD
UniProt number: P29279
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CCN2, CTGF, Connective Tissue Growth Factor
Short name: CCN2, CTGF, Recombinant Connective Tissue Growth Factor
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CCN2, connective tissue growth factor, sapiens Connective Tissue Growth Factor, recombinant H
Alternative technique: rec
Alternative to gene target: CCN2 and HCS24 and IGFBP8 and NOV2, CTGF and IDBG-633353 and ENSBTAG00000006367 and 281103, CTGF and IDBG-96631 and ENSG00000118523 and 1490, Ctgf and IDBG-138628 and ENSMUSG00000019997 and 14219, Extracellular, heparin binding, this GO :0001502 and cartilage condensation and biological process this GO :0001503 and ossification and biological process this GO :0001525 and angiogenesis and biological process this GO :0001558 and regulation of cell growth and biological process this GO :0001894 and tissue homeostasis and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0001968 and fibronectin binding and molecular function this GO :0005178 and integrin binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005520 and insulin-like growth factor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005578 and proteinaceous extracellular matrix and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005801 and cis- this GO lgi network and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005938 and cell cortex and cellular component this GO :0006260 and DNA replication and biological process this GO :0006367 and transcription initiation from RNA polymerase II promoter and biological process this GO :0007160 and cell-matrix adhesion and biological process this GO :0007229 and integrin-mediated signaling pathway and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008201 and heparin binding and molecular function this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0008544 and epidermis development and biological process this GO :0009611 and response to wounding and biological process this GO :0009749 and response to glucose and biological process this GO :0010260 and organ senescence and biological process this GO :0010467 and gene expression and biological process this GO :0010628 and positive regulation of gene expression and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0010942 and positive regulation of cell death and biological process this GO :0014070 and response to organic cyclic compound and biological process this GO :0016477 and cell migration and biological process this GO :0030154 and cell differentiation and biological process this GO :0030324 and lung development and biological process this GO :0032330 and regulation of chondrocyte differentiation and biological process this GO :0032355 and response to estradiol and biological process this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034059 and response to anoxia and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0035988 and chondrocyte proliferation and biological process this GO :0043200 and response to amino acid and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0043280 and positive regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043434 and response to peptide hormone and biological process this GO :0044255 and cellular lipid metabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045597 and positive regulation of cell differentiation and biological process this GO :0046330 and positive regulation of JNK cascade and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0050867 and positive regulation of cell activation and biological process this GO :0051385 and response to mineralocorticoid and biological process this GO :0051496 and positive regulation of stress fiber assembly and biological process this GO :0060401 and cytosolic calcium ion transport and biological process this GO :0060452 and positive regulation of cardiac muscle contraction and biological process this GO :0060548 and negative regulation of cell death and biological process this GO :0061448 and connective tissue development and biological process this GO :0070278 and extracellular matrix constituent secretion and biological process this GO :0070318 and positive regulation of G0 to G1 transition and biological process this GO :0070374 and positive regulation of ERK1 and ERK2 cascade and biological process this GO :0070542 and response to fatty acid and biological process this GO :0072593 and reactive oxygen species metabolic process and biological process, this GO :0001968 : fibronectin binding, this GO :0001968 : fibronectin binding and also this GO :0005178 : integrin binding and also this GO :0005515 : protein binding and also this GO :0005520 : insulin-like growth factor binding and also this GO :0008083 : growth factor activity and also this GO :0008201 : heparin binding, this GO :0005178 : integrin binding, this GO :0005515 : protein binding, this GO :0005520 : insulin-like growth factor binding, this GO :0008083 : growth factor activity, this GO :0008201 : heparin binding, connective tissue growth factor
Identity: 2500
Gene: CTGF | More about : CTGF
Long gene name: connective tissue growth factor
Synonyms: IGFBP8 CCN2
Locus: 6q23, 2
Discovery year: 1992-12-01
GenBank acession: X78947
Entrez gene record: 1490
Pubmed identfication: 1654338
RefSeq identity: NM_001901
Classification: CYR61/CTGF/NOV matricellular proteins
Havana BLAST/BLAT: OTTHUMG00000015573

Related Products :

MBS613716 CTGF (CCN2, Connective Tissue Growth Factor, Hcs24, Hypertrophic chondrocyte-specific gene product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8, MGC102839, NOV2) Antibody 100ul 630 € MBS Polyclonals_1 human
MBS614804 CTGF (Connective Tissue Growth Factor, CCN2, Hcs24, Hypertrophic Chondrocyte-specific Gene Product 24, IGFBP8, Insulin-like Growth Factor-Binding Protein 8) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS619169 CTGF (Connective Tissue Growth Factor, CCN2, Hypertrophic Chondrocyte-specific Gene Product 24, Hcs24, Insulin-like Growth Factor-Binding Protein 8, IGFBP8, MGC102839, NOV2) (Biotin) Antibody 50ug 774 € MBS Polyclonals_1 human
CM22 Recombinant Human Connective Tissue Growth Factor, CTGF, CCN2 50 µg 369 € novo human
CI07 Recombinant Human Connective Tissue Growth Factor, CTGF, CCN2 (C-Fc) 500 µg 1613 € novo human
AE48526HU-48 ELISA test for Human Connective tissue growth factor (CTGF) 1x plate of 48 wells 402 € abebio human
GENTAUR-58bb4340e28b1 Human Connective tissue growth factor (CTGF) 100ug 1929 € MBS Recombinant Proteins human
GENTAUR-58bb434148404 Human Connective tissue growth factor (CTGF) 1000ug 1929 € MBS Recombinant Proteins human
GENTAUR-58bb43418aa2f Human Connective tissue growth factor (CTGF) 100ug 2442 € MBS Recombinant Proteins human
GENTAUR-58bb4341d9ae3 Human Connective tissue growth factor (CTGF) 1000ug 2442 € MBS Recombinant Proteins human
AE48526HU Human Connective tissue growth factor (CTGF) ELISA Kit 48 wells plate 500 € ab-elisa elisas human
AE48526HU-96 Human Connective tissue growth factor (CTGF) ELISA Kit 1x plate of 96 wells 671 € abebio human
DL-CTGF-Hu Human Connective Tissue Growth Factor CTGF ELISA Kit 96T 672 € DL elisas human
KT-11956 Human Connective Tissue Growth Factor (CTGF) ELISA kit 96 well plate 1113 € Kamiya human
KT-50296 Human Connective Tissue Growth Factor (CTGF) ELISA kit 96 well plate 1068 € Kamiya human
GENTAUR-58bdc3c12ee3d Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4172ff32 Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 498 € MBS Polyclonals human
GENTAUR-58bdc4b7f139b Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 520 € MBS Polyclonals human
GENTAUR-58bdc4b855301 Anti- Connective Tissue Growth Factor (CTGF) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdc52955c12 Anti- Connective Tissue Growth Factor (CTGF) Antibody 50ug 409 € MBS Polyclonals human
GENTAUR-58bdc529b2f81 Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 553 € MBS Polyclonals human
GENTAUR-58bdca5d08ba1 Anti- Connective Tissue Growth Factor (CTGF) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdca5d8d809 Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdcd4d04d3e Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 481 € MBS Polyclonals human
GENTAUR-58bdcd4da76e2 Anti- Connective Tissue Growth Factor (CTGF) Antibody 50ug 370 € MBS Polyclonals human
GENTAUR-58bdd04b854da Anti- Connective Tissue Growth Factor (CTGF) Antibody 50ug 332 € MBS Polyclonals human
GENTAUR-58bdd04c05ad0 Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 409 € MBS Polyclonals human
GENTAUR-58bdd07a7eefd Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 459 € MBS Polyclonals human
GENTAUR-58bdd07ae030b Anti- Connective Tissue Growth Factor (CTGF) Antibody 50ug 359 € MBS Polyclonals human
GENTAUR-58bdd11ff39ab Anti- Connective Tissue Growth Factor (CTGF) Antibody 100ug 442 € MBS Polyclonals human