Recombinant Carassius Auratus Leptin (N-8His)

Contact us
Catalog number: CM20
Price: 2144 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Carassius Auratus Leptin (N-8His)
Quantity: 1000ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus
Molecular Weight: 18, 3 kD
UniProt number: B8YI02
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Gene: ", Both hormones act on receptors in the , ELISA kits and peptides and antibodies are available, Leptin is opposed by the actions of the hormone , the ", &epsilon, &lambda,  ,  , &pi, &tau, (from , ) the ", Greek , Human or mouse Leptin , adipose cells , arcuate nucleus , by inhibiting hunger, energy balance , energy homeostasis, ghrelin, hormone , hunger hormone", is a , leptos, made by , of the hypothalamus , satiety hormone", that helps to regulate , thin", to regulate appetite to achieve , ό&sigmaf | More about : ", Both hormones act on receptors in the , ELISA kits and peptides and antibodies are available, Leptin is opposed by the actions of the hormone , the ", &epsilon, &lambda,  ,  , &pi, &tau, (from , ) the ", Greek , Human or mouse Leptin , adipose cells , arcuate nucleus , by inhibiting hunger, energy balance , energy homeostasis, ghrelin, hormone , hunger hormone", is a , leptos, made by , of the hypothalamus , satiety hormone", that helps to regulate , thin", to regulate appetite to achieve , ό&sigmaf
Group: recombinants
Gene target: Carassius Auratus Leptin (N-8His)
Short name: Recombinant Carassius Auratus Leptin (N-8His)
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: recombinant Carassius Auratus Leptin (N-8His)
Alternative technique: rec

Related Products :

CM20 Recombinant Carassius Auratus Leptin (N-8His) 500 µg 1613 € novo human
CP72 Recombinant Cynomolgus Tumor Necrosis Factor Ligand 2B, OX40L(N-8His) 500 µg 2536 € novo human
C688 Recombinant Human Dickkopf-Related Protein 1, DKK1 (N-8His) 10 µg 202 € novo human
CS40 Recombinant Human Fc epsilon RII, CD23 (N-8His) 500 µg 1613 € novo human
CP84 Recombinant Human Fibrillin-1, Asprosin (N-8His) 50 µg 496 € novo human
CM21 Recombinant Human Isocitrate Dehydrogenase 1, IDH1 (C-8His) 50 µg 496 € novo human
CM34 Recombinant Human Isocitrate Dehydrogenase 1, IDH1 (R132H, C-8His) 1 mg 2283 € novo human
CB20 Recombinant Human NKG2-A, NKG2-B Type II Integral Membrane Protein(N-8His) 50 µg 141 € novo human
CS55 Recombinant Human NKG2A & CD94 Heterodimer (N-8His & N-Flag) 500 µg 1186 € novo human
C018 Recombinant Human Noggin, NOG (N-8His-Flag) 10 µg 156 € novo human
CB42 Recombinant Human Parathyroid Hormone, PTH (N-8His) 10 µg 126 € novo human
CP01 Recombinant Human Serum Albumin, HSA (C-8His) 50 µg 141 € novo human
CA72 Recombinant Human Transforming Growth Factor β-1, TGFB1 (N-8His) 500 µg 1328 € novo human
C773 Recombinant Mouse Dickkopf-Related Protein 1, mDKK1, DKK-1 (N-8His) 500 µg 1613 € novo mouse
CC27 Recombinant Mouse Fibrillin-1, Asprosin (N-8His) 10 µg 202 € novo mouse
CM74 Recombinant Mouse OX40 Ligand, TNFSF4, OX40L (N-8His) 50 µg 369 € novo mouse
GENTAUR-58b382aa743b4 Carassius auratus Actin, alpha skeletal muscle (acta1) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b382aab6cf1 Carassius auratus Actin, alpha skeletal muscle (acta1) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b382aadeda5 Carassius auratus Actin, alpha skeletal muscle (acta1) 100ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b382ab2454d Carassius auratus Actin, alpha skeletal muscle (acta1) 1000ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b43c49789e8 Carassius auratus Actin, alpha skeletal muscle (acta1) 100ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b43c49eeade Carassius auratus Actin, alpha skeletal muscle (acta1) 1000ug 2067 € MBS Recombinant Proteins human
GENTAUR-58b43c4a5d6de Carassius auratus Actin, alpha skeletal muscle (acta1) 100ug 2575 € MBS Recombinant Proteins human
GENTAUR-58b43c4acd965 Carassius auratus Actin, alpha skeletal muscle (acta1) 1000ug 2575 € MBS Recombinant Proteins human
GENTAUR-58bc62f4e6db4 Carassius auratus ATP synthase protein 8 (mt-atp8) 100ug 1249 € MBS Recombinant Proteins human
GENTAUR-58bc62f52bfed Carassius auratus ATP synthase protein 8 (mt-atp8) 1000ug 1249 € MBS Recombinant Proteins human
GENTAUR-58bc62f57bd24 Carassius auratus ATP synthase protein 8 (mt-atp8) 100ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bc62f5cc13b Carassius auratus ATP synthase protein 8 (mt-atp8) 1000ug 1752 € MBS Recombinant Proteins human
GENTAUR-58bcb618499c7 Carassius auratus ATP synthase subunit a (mt-atp6) 1000ug 1636 € MBS Recombinant Proteins human
GENTAUR-58bcb618a3415 Carassius auratus ATP synthase subunit a (mt-atp6) 1000ug 2144 € MBS Recombinant Proteins human