| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Carassiusauratus Leptin is produced by our Yeast expression system and the target gene encoding Pro22-Cys171 is expressed with a 8His tag at the N-terminus |
| Molecular Weight: |
18, 3 kD |
| UniProt number: |
B8YI02 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HHHHHHHHPVHPDRLKNMVKLQADTIILRIKDHNEKLKLYPKLLIGDPELYPEVPADRHIQGLGSIMDTLTIFQKVLQRLPKGHVSQIRSDLSTLLGYLKERTTSMHCILKEPANGRSLDAFLEENATHHITLGYLALDRLKQFMQKLIVNLDQLKSC |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Gene: |
", Both hormones act on receptors in the , ELISA kits and peptides and antibodies are available, Leptin is opposed by the actions of the hormone , the ", &epsilon, &lambda, , , &pi, &tau, (from , ) the ", Greek , Human or mouse Leptin , adipose cells , arcuate nucleus , by inhibiting hunger, energy balance , energy homeostasis, ghrelin, hormone , hunger hormone", is a , leptos, made by , of the hypothalamus , satiety hormone", that helps to regulate , thin", to regulate appetite to achieve , ό&sigmaf |
More about : ", Both hormones act on receptors in the , ELISA kits and peptides and antibodies are available, Leptin is opposed by the actions of the hormone , the ", &epsilon, &lambda, , , &pi, &tau, (from , ) the ", Greek , Human or mouse Leptin , adipose cells , arcuate nucleus , by inhibiting hunger, energy balance , energy homeostasis, ghrelin, hormone , hunger hormone", is a , leptos, made by , of the hypothalamus , satiety hormone", that helps to regulate , thin", to regulate appetite to achieve , ό&sigmaf |
| Group: |
recombinants |
| Gene target: |
Carassius Auratus Leptin (N-8His) |
| Short name: |
Recombinant Carassius Auratus Leptin (N-8His) |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Alternative name: |
recombinant Carassius Auratus Leptin (N-8His) |
| Alternative technique: |
rec |