Recombinant Human Peroxiredoxin-5, PRDX5 (N-6His)

Contact us
Catalog number: CK91
Price: 389 €
Supplier: NJS poly
Product name: Recombinant Human Peroxiredoxin-5, PRDX5 (N-6His)
Quantity: 0.1mg
Other quantities: 1 mg 2283€ 50 µg 303€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Peroxiredoxin-5 is produced by our Mammalian expression system and the target gene encoding Met53-Leu214 is expressed with a 6His tag at the N-terminus
Molecular Weight: 17, 9 kD
UniProt number: P30044
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: HHHHHHMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PRDX5 (N-6His), Peroxiredoxin-5
Short name: PRDX5 (N-6His), Recombinant Peroxiredoxin-5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: peroxiredoxin 5 (N-6His), sapiens Peroxiredoxin-5, recombinant H
Alternative technique: rec
Alternative to gene target: ACR1 and AOEB166 and B166 and HEL-S-55 and PLP and PMP20 and PRDX6 and prx-V and PRXV, PRDX5 and IDBG-53649 and ENSG00000126432 and 25824, PRDX5 and IDBG-643929 and ENSBTAG00000008648 and 282885, Prdx5 and IDBG-136962 and ENSMUSG00000024953 and 54683, nuclei, peroxynitrite reductase activity, this GO :0001016 and RNA polymerase III regulatory region DNA binding and molecular function this GO :0004601 and peroxidase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005782 and peroxisomal matrix and cellular component this GO :0005829 and cytosol and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0016209 and antioxidant activity and molecular function this GO :0016480 and negative regulation of transcription from RNA polymerase III promoter and biological process this GO :0016491 and oxidoreductase activity and molecular function this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034614 and cellular response to reactive oxygen species and biological process this GO :0042744 and hydrogen peroxide catabolic process and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0046983 and protein dimerization activity and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051354 and negative regulation of oxidoreductase activity and biological process this GO :0051920 and peroxiredoxin activity and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0060785 and regulation of apoptosis involved in tissue homeostasis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070995 and NADPH oxidation and biological process this GO :0072541 and peroxynitrite reductase activity and molecular function this GO :2001057 and reactive nitrogen species metabolic process and biological process this GO :2001141 and regulation of RNA biosynthetic process and biological process, this GO :0001016 : RNA polymerase III regulatory region DNA binding, this GO :0001016 : RNA polymerase III regulatory region DNA binding and also this GO :0004601 : peroxidase activity and also this GO :0005102 : receptor binding and also this GO :0016209 : antioxidant activity and also this GO :0016491 : oxidoreductase activity and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process and also this GO :0046983 : protein dimerization activity and also this GO :0051920 : peroxiredoxin activity and also this GO :0072541 : peroxynitrite reductase activity, this GO :0004601 : peroxidase activity, this GO :0005102 : receptor binding, this GO :0016209 : antioxidant activity, this GO :0016491 : oxidoreductase activity, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0046983 : protein dimerization activity, this GO :0051920 : peroxiredoxin activity, this GO :0072541 : peroxynitrite reductase activity, peroxiredoxin 5
Identity: 9355
Gene: PRDX5 | More about : PRDX5
Long gene name: peroxiredoxin 5
Synonyms: ACR1 AOEB166 MGC142285 PRXV PMP20 B166 PRDX6 PLP SBBI10 MGC117264 MGC142283
Synonyms name: antioxidant enzyme B166 thioredoxin peroxidase PMP20 peroxisomal antioxidant enzyme TPx type VI liver tissue 2D-page spot 71B Alu co-repressor 1
Locus: 11q13, 1
Discovery year: 2000-07-31
GenBank acession: AF197952
Entrez gene record: 25824
Pubmed identfication: 10514471 10521424
RefSeq identity: NM_181651
Classification: Peroxiredoxins
Havana BLAST/BLAT: OTTHUMG00000168805

Related Products :

CK91 Recombinant Human Peroxiredoxin-5, PRDX5 (N-6His) 50 µg 303 € novo human
RP-1202H Recombinant Human Peroxiredoxin 5 / PRDX5 Protein (His Tag) 20μg 572 € adv human
RP-1445M Recombinant Mouse Peroxiredoxin 5 / PRDX5 Protein (His Tag) 50μg 572 € adv mouse
MBS618043 Peroxiredoxin 4 (Peroxiredoxin-4, PRDX4, PRX-4, Peroxiredoxin IV, Prx-IV, Antioxidant Enzyme AOE372, AOE37-2, Thioredoxin Peroxidase AO372, Thioredoxin-dependent Peroxide Reductase A0372) 0.05 ml 663 € MBS Polyclonals_1 human
abx573523 Anti-Human Peroxiredoxin 5 (PRDX5) ELISA Kit inquire 50 € abbex human
DL-PRDX5-Hu Human Peroxiredoxin 5 PRDX5 ELISA Kit 96T 904 € DL elisas human
GENTAUR-58bde78082961 Mouse Monoclonal [clone 12A] (IgG2a,k) to Human PRDX5 / Peroxiredoxin 5 Antibody 0.05 ml 597 € MBS mono human
AR09220PU-L anti-Peroxiredoxin-5 / PRDX5 (53-214) Antibody 0,5 mg 1138 € acr human
AR09220PU-N anti-Peroxiredoxin-5 / PRDX5 (53-214) Antibody 0,1 mg 485 € acr human
AM31913PU-N anti-Peroxiredoxin-5 / PRDX5 Antibody 50 Вµl 732 € acr human
AM50639PU-N anti-Peroxiredoxin-5 / PRDX5 Antibody 0,1 ml 500 € acr human
AM50639PU-S anti-Peroxiredoxin-5 / PRDX5 Antibody 50 Вµl 369 € acr human
BB-PA1838 anti-Peroxiredoxin-5 / PRDX5 Antibody 0,1 mg 471 € acr human
GENTAUR-58bdc1ac2be6b Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 542 € MBS Polyclonals human
GENTAUR-58bdc37754197 Anti- Peroxiredoxin 5 (PRDX5) Antibody 50ug 376 € MBS Polyclonals human
GENTAUR-58bdc377bba8a Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 492 € MBS Polyclonals human
GENTAUR-58bdc83c70db0 Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 525 € MBS Polyclonals human
GENTAUR-58bdc83ccfea5 Anti- Peroxiredoxin 5 (PRDX5) Antibody 50ug 398 € MBS Polyclonals human
GENTAUR-58bdcd1c9877f Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 503 € MBS Polyclonals human
GENTAUR-58bdcd1d0fa8f Anti- Peroxiredoxin 5 (PRDX5) Antibody 50ug 382 € MBS Polyclonals human
GENTAUR-58bdcd7191f25 Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 531 € MBS Polyclonals human
GENTAUR-58bdcedb7daf5 Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd4c057202 Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 564 € MBS Polyclonals human
GENTAUR-58bdd9ad72c75 Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 603 € MBS Polyclonals human
GENTAUR-58bdda9ed9ff7 Anti- Peroxiredoxin 5 (PRDX5) Antibody 100ug 575 € MBS Polyclonals human
GENTAUR-58b8194fa83e2 Mesocricetus auratus Peroxiredoxin-5, mitochondrial (PRDX5) 1000ug 1105 € MBS Recombinant Proteins human
GENTAUR-58b819501070f Mesocricetus auratus Peroxiredoxin-5, mitochondrial (PRDX5) 1000ug 1614 € MBS Recombinant Proteins human
GENTAUR-58b842d148d68 Mesocricetus auratus Peroxiredoxin-5, mitochondrial (PRDX5) 1000ug 1105 € MBS Recombinant Proteins human
GENTAUR-58b842d1a85d2 Mesocricetus auratus Peroxiredoxin-5, mitochondrial (PRDX5) 1000ug 1614 € MBS Recombinant Proteins human
R30936 Peroxiredoxin 5 Antibody (PRDX5) 0.1mg 389 € NJS poly human