| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Peroxiredoxin-5 is produced by our Mammalian expression system and the target gene encoding Met53-Leu214 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
17, 9 kD |
| UniProt number: |
P30044 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
HHHHHHMAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PRDX5 (N-6His), Peroxiredoxin-5 |
| Short name: |
PRDX5 (N-6His), Recombinant Peroxiredoxin-5 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
peroxiredoxin 5 (N-6His), sapiens Peroxiredoxin-5, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACR1 and AOEB166 and B166 and HEL-S-55 and PLP and PMP20 and PRDX6 and prx-V and PRXV, PRDX5 and IDBG-53649 and ENSG00000126432 and 25824, PRDX5 and IDBG-643929 and ENSBTAG00000008648 and 282885, Prdx5 and IDBG-136962 and ENSMUSG00000024953 and 54683, nuclei, peroxynitrite reductase activity, this GO :0001016 and RNA polymerase III regulatory region DNA binding and molecular function this GO :0004601 and peroxidase activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0005777 and peroxisome and cellular component this GO :0005782 and peroxisomal matrix and cellular component this GO :0005829 and cytosol and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006979 and response to oxidative stress and biological process this GO :0016209 and antioxidant activity and molecular function this GO :0016480 and negative regulation of transcription from RNA polymerase III promoter and biological process this GO :0016491 and oxidoreductase activity and molecular function this GO :0031410 and cytoplasmic vesicle and cellular component this GO :0032967 and positive regulation of collagen biosynthetic process and biological process this GO :0034614 and cellular response to reactive oxygen species and biological process this GO :0042744 and hydrogen peroxide catabolic process and biological process this GO :0043027 and cysteine-type endopeptidase inhibitor activity involved in apoptotic process and molecular function this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043154 and negative regulation of cysteine-type endopeptidase activity involved in apoptotic process and biological process this GO :0043231 and intracellular membrane-bounded organelle and cellular component this GO :0046983 and protein dimerization activity and molecular function this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0051354 and negative regulation of oxidoreductase activity and biological process this GO :0051920 and peroxiredoxin activity and molecular function this GO :0055114 and oxidation-reduction process and biological process this GO :0060785 and regulation of apoptosis involved in tissue homeostasis and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070995 and NADPH oxidation and biological process this GO :0072541 and peroxynitrite reductase activity and molecular function this GO :2001057 and reactive nitrogen species metabolic process and biological process this GO :2001141 and regulation of RNA biosynthetic process and biological process, this GO :0001016 : RNA polymerase III regulatory region DNA binding, this GO :0001016 : RNA polymerase III regulatory region DNA binding and also this GO :0004601 : peroxidase activity and also this GO :0005102 : receptor binding and also this GO :0016209 : antioxidant activity and also this GO :0016491 : oxidoreductase activity and also this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process and also this GO :0046983 : protein dimerization activity and also this GO :0051920 : peroxiredoxin activity and also this GO :0072541 : peroxynitrite reductase activity, this GO :0004601 : peroxidase activity, this GO :0005102 : receptor binding, this GO :0016209 : antioxidant activity, this GO :0016491 : oxidoreductase activity, this GO :0043027 : cysteine-type endopeptidase inhibitor activity involved in apoptotic process, this GO :0046983 : protein dimerization activity, this GO :0051920 : peroxiredoxin activity, this GO :0072541 : peroxynitrite reductase activity, peroxiredoxin 5 |
| Identity: |
9355 |
| Gene: |
PRDX5 |
More about : PRDX5 |
| Long gene name: |
peroxiredoxin 5 |
| Synonyms: |
ACR1 AOEB166 MGC142285 PRXV PMP20 B166 PRDX6 PLP SBBI10 MGC117264 MGC142283 |
| Synonyms name: |
antioxidant enzyme B166 thioredoxin peroxidase PMP20 peroxisomal antioxidant enzyme TPx type VI liver tissue 2D-page spot 71B Alu co-repressor 1 |
| Locus: |
11q13, 1 |
| Discovery year: |
2000-07-31 |
| GenBank acession: |
AF197952 |
| Entrez gene record: |
25824 |
| Pubmed identfication: |
10514471 10521424 |
| RefSeq identity: |
NM_181651 |
| Classification: |
Peroxiredoxins |
| Havana BLAST/BLAT: |
OTTHUMG00000168805 |