| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human B7 Homolog 3 is produced by our Mammalian expression system and the target gene encoding Leu29-Thr461 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
3 kD, 47 |
| UniProt number: |
Q5ZPR3 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD276 (C-6His), B7-H3 |
| Short name: |
CD276 (C-6His), Recombinant B7-H3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD276 molecule (C-6His), sapiens B7-H3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CD276 and IDBG-21197 and ENSG00000103855 and 80381, CD276 and IDBG-645646 and ENSBTAG00000019734 and 508656, Cd276 and IDBG-172080 and ENSMUSG00000035914 and 102657, Cell surfaces, protein binding, this GO :0005102 and receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0006955 and immune response and biological process this GO :0008283 and cell proliferation and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0016021 and integral component of membrane and cellular component this GO :0030501 and positive regulation of bone mineralization and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0042130 and negative regulation of T cell proliferation and biological process this GO :0045077 and negative regulation of interferon-gamma biosynthetic process and biological process this GO :0045078 and positive regulation of interferon-gamma biosynthetic process and biological process this GO :0045085 and negative regulation of interleukin-2 biosynthetic process and biological process this GO :0045669 and positive regulation of osteoblast differentiation and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050776 and regulation of immune response and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :1900042 and positive regulation of interleukin-2 secretion and biological process, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005515 : protein binding, this GO :0005515 : protein binding, CD276 molecule |
| Identity: |
19137 |
| Gene: |
CD276 |
More about : CD276 |
| Long gene name: |
CD276 molecule |
| Synonyms gene name: |
CD276 antigen |
| Synonyms: |
B7-H3 B7H3 B7RP-2 |
| Locus: |
15q24, 1 |
| Discovery year: |
2005-03-04 |
| GenBank acession: |
AF302102 |
| Entrez gene record: |
80381 |
| Pubmed identfication: |
11224528 12055244 |
| RefSeq identity: |
NM_025240 |
| Classification: |
C2-set domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000137585 |