Recombinant Human B7-1, CD80 (C-6His)

Contact us
Catalog number: CK61
Price: 967 €
Supplier: accurate-monoclonals
Product name: Recombinant Human B7-1, CD80 (C-6His)
Quantity: 0.1mg
Other quantities: 10 µg 80€ 50 µg 141€ 500 µg 659€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus
Molecular Weight: 24, 7 kD
UniProt number: P33681
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD80 (C-6His), B7-1
Short name: CD80 (C-6His), Recombinant B7-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD80 molecule (C-6His), sapiens B7-1, recombinant H
Alternative technique: rec
Alternative to gene target: B7 and B7-1 and B7, BT, CD80 and IDBG-51287 and ENSG00000121594 and 941, Cd80 and IDBG-160288 and ENSMUSG00000075122 and 12519, Cell surfaces, DNA-templated and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process, coreceptor activity, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009967 and positive regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045425 and positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process and biological process this GO :0045627 and positive regulation of T-helper 1 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity, this GO :0015026 : coreceptor activity, 1 and BB1 and CD28LG and CD28LG1 and LAB7, 27986 and IDBG-632750 and ENSBTAG00000018059 and 407131, CD80 molecule
Identity: 1700
Gene: CD80 | More about : CD80
Long gene name: CD80 molecule
Synonyms gene: CD28LG CD28LG1
Synonyms gene name: B7-1 antigen) CD80 molecule , CD80 antigen (CD28 antigen ligand 1
Synonyms: B7, 1 B7-1
Synonyms name: B-lymphocyte activation antigen B7
Locus: 3q13, 33
Discovery year: 1993-12-14
Entrez gene record: 941
Pubmed identfication: 1370389
RefSeq identity: NM_005191
Classification: C2-set domain containing CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000159419

Related Products :

CK61 Recombinant Human B7-1, CD80 (C-6His) 500 µg 659 € novo human
CP54 Recombinant Cynomologous B7-1, CD80 (C-6His) 500 µg 659 € novo human
CP55 Recombinant Mouse B7-1, CD80 (C-6His) 50 µg 141 € novo mouse
CP57 Recombinant Rabbit B7-1, CD80 (C-6His) 500 µg 709 € novo human
CP56 Recombinant Rat T-lymphocyte Activation Antigen CD80, B7-1 (C-6His) 1 mg 2283 € novo rat
RP-0364H Recombinant Human CD80 / B7-1 Protein 100μg 659 € adv human
RP-0365H Recombinant Human CD80 / B7-1 Protein (His & Fc Tag) 100μg 659 € adv human
RP-0363H Recombinant Human CD80 / B7-1 Protein (His Tag) 100μg 659 € adv human
RP-1056RC Recombinant Cynomolgus CD80 / B7-1 Protein (Fc Tag) 100μg 659 € adv human
CK87 Recombinant Mouse B7-1, CD80 (C-Fc) 50 µg 141 € novo mouse
RP-1164M Recombinant Mouse CD80 / B7-1 / CD28LG Protein (His Tag) 100μg 659 € adv mouse
RP-1163M Recombinant Mouse CD80 / B7-1 Protein (Fc Tag) 100μg 659 € adv mouse
BB-EK0707 anti-Human B7-1/CD80 ELISA Kit Antibody 96 Tests 717 € acr human
101-M315 Anti-Human CD80 100ug 336 € Reliatech antibodies human
CEK1112 anti-Human CD80 ELISA Kit Antibody 96 Tests 703 € acr human
abx250225 Anti-Human T-lymphocyte activation antigen CD80 ELISA Kit 96 tests 659 € abbex human
CLBM1708 CD80, B7-1, BB1, Clone: CLB-DAL1, Mouse Monoclonal antibody-Human 1000ul 674 € accurate-monoclonals human
YSRTMCA1735F CD80, B7-1, Clone: DAL-1, Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1735 CD80, B7-1, Clone: DAL-1, Mouse Monoclonal antibody-Human; flow 0.1 mg Ask price € accurate-monoclonals human
YSRTMCA1735C CD80, B7-1, Clone: DAL-1, Mouse Monoclonal antibody-Human, RPE-Cy5; flow vial Ask price € accurate-monoclonals human
YSRTMCA1735PE CD80, B7-1, Clone: DAL-1, Mouse Monoclonal antibody-Human, RPE; flow vial Ask price € accurate-monoclonals human
OBT4508B CD80, B7-1, Clone: MEM-233, Mouse Monoclonal antibody-Human, Biotin; flow 0.1 mg Ask price € accurate-monoclonals human
OBT4508F CD80, B7-1, Clone: MEM-233, Mouse Monoclonal antibody-Human, FITC; flow 0.1 mg Ask price € accurate-monoclonals human
OBT4508 CD80, B7-1, Clone: MEM-233, Mouse Monoclonal antibody-Human; flow/IP/WB 200ug Ask price € accurate-monoclonals human
OBT4508RC CD80, B7-1, Clone: MEM-233, Mouse Monoclonal antibody-Human, RPE-Cy5; flow vial Ask price € accurate-monoclonals human
OBT4508R CD80, B7-1, Clone: MEM-233, Mouse Monoclonal antibody-Human, RPE; flow vial Ask price € accurate-monoclonals human
OBT3254 CD80, B7, B-Cell activated, Clone: BB1, Mouse Monoclonal antibody-Human 0.1 mg Ask price € accurate-monoclonals human
OBT3254B CD80, B7, B-Cell activated, Clone: BB1, Mouse Monoclonal antibody-Human, Biotin 100 tests Ask price € accurate-monoclonals human
OBT3254F CD80, B7, B-Cell activated, Clone: BB1, Mouse Monoclonal antibody-Human, FITC 100 tests Ask price € accurate-monoclonals human
YM2071 CD80, B7, BB1, 60kD, Clone: MEM-233, Mouse Monoclonal antibody-Human; flow/IP/WB (non-reducing condits) 0.1mg 967 € accurate-monoclonals human