| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Activation B7-1 antigen is produced by our Mammalian expression system and the target gene encoding Val35-Asn242 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
24, 7 kD |
| UniProt number: |
P33681 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
pH 7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD80 (C-6His), B7-1 |
| Short name: |
CD80 (C-6His), Recombinant B7-1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD80 molecule (C-6His), sapiens B7-1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
B7 and B7-1 and B7, BT, CD80 and IDBG-51287 and ENSG00000121594 and 941, Cd80 and IDBG-160288 and ENSMUSG00000075122 and 12519, Cell surfaces, DNA-templated and biological process this GO :0046641 and positive regulation of alpha-beta T cell proliferation and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process, coreceptor activity, this GO :0005515 and protein binding and molecular function this GO :0005886 and plasma membrane and cellular component this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0009967 and positive regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0015026 and coreceptor activity and molecular function this GO :0016021 and integral component of membrane and cellular component this GO :0016032 and viral process and biological process this GO :0031295 and T cell costimulation and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042110 and T cell activation and biological process this GO :0045086 and positive regulation of interleukin-2 biosynthetic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045425 and positive regulation of granulocyte macrophage colony-stimulating factor biosynthetic process and biological process this GO :0045627 and positive regulation of T-helper 1 cell differentiation and biological process this GO :0045893 and positive regulation of transcription, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0015026 : coreceptor activity, this GO :0015026 : coreceptor activity, 1 and BB1 and CD28LG and CD28LG1 and LAB7, 27986 and IDBG-632750 and ENSBTAG00000018059 and 407131, CD80 molecule |
| Identity: |
1700 |
| Gene: |
CD80 |
More about : CD80 |
| Long gene name: |
CD80 molecule |
| Synonyms gene: |
CD28LG CD28LG1 |
| Synonyms gene name: |
B7-1 antigen) CD80 molecule , CD80 antigen (CD28 antigen ligand 1 |
| Synonyms: |
B7, 1 B7-1 |
| Synonyms name: |
B-lymphocyte activation antigen B7 |
| Locus: |
3q13, 33 |
| Discovery year: |
1993-12-14 |
| Entrez gene record: |
941 |
| Pubmed identfication: |
1370389 |
| RefSeq identity: |
NM_005191 |
| Classification: |
C2-set domain containing CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000159419 |