| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Glutathione S-Transferase pi 1 is produced by our E, coli expression system and the target gene encoding Met1-Glu210 is expressed |
| Molecular Weight: |
23, 5 kD |
| UniProt number: |
P09211 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0, pH 8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MMPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYVSLIYTNYEAGKDDYVKALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGRLSARPKLKAFLASPEYVNLPINGNGKQ |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
GSTP1, Glutathione S-transferase P |
| Short name: |
GSTP1, Recombinant Glutathione S-transferase P |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
glutathione S-transferase pi 1, sapiens GSH S-transferase P, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
DFN7 and FAEES3 and GST3 and GSTP and HEL-S-22 and PI, GSTP1 and IDBG-60718 and ENSG00000084207 and 2950, GSTP1 and IDBG-644794 and ENSBTAG00000003548 and 281806, nitric oxide binding, nuclei, this GO :0000302 and response to reactive oxygen species and biological process this GO :0002674 and negative regulation of acute inflammatory response and biological process this GO :0004364 and glutathione transferase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005622 and intracellular and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006469 and negative regulation of protein kinase activity and biological process this GO :0006749 and glutathione metabolic process and biological process this GO :0006805 and xenobiotic metabolic process and biological process this GO :0007417 and central nervous system development and biological process this GO :0008152 and metabolic process and biological process this GO :0008432 and JUN kinase binding and molecular function this GO :0009890 and negative regulation of biosynthetic process and biological process this GO :0010804 and negative regulation of tumor necrosis factor-mediated signaling pathway and biological process this GO :0019207 and kinase regulator activity and molecular function this GO :0032691 and negative regulation of interleukin-1 beta production and biological process this GO :0032720 and negative regulation of tumor necrosis factor production and biological process this GO :0032872 and regulation of stress-activated MAPK cascade and biological process this GO :0032873 and negative regulation of stress-activated MAPK cascade and biological process this GO :0032930 and positive regulation of superoxide anion generation and biological process this GO :0035726 and common myeloid progenitor cell proliferation and biological process this GO :0035730 and S-nitrosoglutathione binding and molecular function this GO :0035731 and dinitrosyl-iron complex binding and molecular function this GO :0035732 and nitric oxide storage and biological process this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043124 and negative regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043407 and negative regulation of MAP kinase activity and biological process this GO :0043409 and negative regulation of MAPK cascade and biological process this GO :0043508 and negative regulation of JUN kinase activity and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045087 and innate immune response and biological process this GO :0048147 and negative regulation of fibroblast proliferation and biological process this GO :0051771 and negative regulation of nitric-oxide synthase biosynthetic process and biological process this GO :0070026 and nitric oxide binding and molecular function this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070372 and regulation of ERK1 and ERK2 cascade and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0070664 and negative regulation of leukocyte proliferation and biological process this GO :0071222 and cellular response to lipopolysaccharide and biological process this GO :0071638 and negative regulation of monocyte chemotactic protein-1 production and biological process this GO :0097057 and TRAF2-GSTP1 complex and cellular component this GO :1901687 and glutathione derivative biosynthetic process and biological process this GO :2001237 and negative regulation of extrinsic apoptotic signaling pathway and biological process, this GO :0004364 : glutathione transferase activity, this GO :0004364 : glutathione transferase activity and also this GO :0005515 : protein binding and also this GO :0008432 : JUN kinase binding and also this GO :0019207 : kinase regulator activity and also this GO :0035730 : S-nitrosoglutathione binding and also this GO :0035731 : dinitrosyl-iron complex binding and also this GO :0070026 : nitric oxide binding, this GO :0005515 : protein binding, this GO :0008432 : JUN kinase binding, this GO :0019207 : kinase regulator activity, this GO :0035730 : S-nitrosoglutathione binding, this GO :0035731 : dinitrosyl-iron complex binding, this GO :0070026 : nitric oxide binding, glutathione S-transferase pi 1 |
| Identity: |
4638 |
| Gene: |
GSTP1 |
More about : GSTP1 |
| Long gene name: |
glutathione S-transferase pi 1 |
| Synonyms gene: |
FAEES3 GST3 |
| Synonyms: |
GSTP |
| Locus: |
11q13, 2 |
| Discovery year: |
1986-01-01 |
| GenBank acession: |
U12472 |
| Entrez gene record: |
2950 |
| Pubmed identfication: |
1885604 7587384 19915149 |
| RefSeq identity: |
NM_000852 |
| Classification: |
Glutathione S-transferases |
| Havana BLAST/BLAT: |
OTTHUMG00000137430 |
| Locus Specific Databases: |
LRG_723 |