Recombinant Human Ephrin-A5, EFNA5 (C-Fc)

Contact us
Catalog number: CJ76
Price: 348 €
Supplier: MBS Polyclonals
Product name: Recombinant Human Ephrin-A5, EFNA5 (C-Fc)
Quantity: 0.12 ml
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Ephrin-A5 is produced by our Mammalian expression system and the target gene encoding Gln21-Asn203 is expressed with a Fc tag at the C-terminus
Molecular Weight: 3 kD, 48
UniProt number: P52803
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGENVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: EFNA5 (C-Fc), Ephrin-A5
Short name: EFNA5 (C-Fc), Recombinant Ephrin-A5
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: EFNA5 (C-fragment c), sapiens Ephrin-A5, recombinant H
Alternative technique: rec
Identity: 3225
Gene: EFNA5 | More about : EFNA5
Long gene name: ephrin A5
Synonyms gene: EPLG7
Synonyms gene name: ephrin-A5
Synonyms: AF1 LERK7
Locus: 5q21, 3
Discovery year: 1995-05-10
GenBank acession: U26403
Entrez gene record: 1946
Pubmed identfication: 8661153 9245480
RefSeq identity: NM_001962
Classification: Ephrins
Havana BLAST/BLAT: OTTHUMG00000128741

Related Products :

CJ76 Recombinant Human Ephrin-A5, EFNA5 (C-Fc) 1 mg 2283 € novo human
CD23 Recombinant Mouse Ephrin-A5, EFNA5 (C-6His) 10 µg 146 € novo mouse
MBS623300 EphA4 (Ephrin Receptor Eph A4, Ephrin Receptor EphA4, Ephrin Type A Receptor 4, EPH Receptor A4, Eph A4, EPH-like Kinase 8, EK8, HEK8, Receptor Protein Tyrosine Kinase HEK8, SEK, TYRO1 Protein Tyrosine Kinase, Tyrosine Protein Kinase Receptor SEK, Tyrosin Antibody 50ug 928 € MBS Polyclonals_1 human
MBS610892 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 50ug 625 € MBS Polyclonals_1 human
MBS613613 Ephrin-A5 (ephrin-A5, AF1, AL-1, EFL5, EPH- related receptor tyrosine kinase ligand 7, Ephrin-A5 precursor, EPLG7, GLC1M, LERK7, LERK-7, RAGS) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS615500 Ephrin B3 (EFNB3, Ephrin B3 (EFL6, EPH-related receptor transmembrane ligand ELK-L3, EPH-related receptor tyrosine kinase ligand 8, Ephrin-B3, EPLG8, LERK8) Antibody 100ug 663 € MBS Polyclonals_1 human
abx571375 Anti-Human Ephrin A5 (EFNA5) ELISA Kit inquire 50 € abbex human
MBS247175 Goat Polyclonal to Human EFNA5 / Ephrin A5 Antibody 50ug 597 € MBS Polyclonals_1 human
DL-EFNA5-Hu Human Ephrin A5 EFNA5 ELISA Kit 96T 904 € DL elisas human
MBS243114 PAb (IgG) to Human EFNA5 / Ephrin A5 Antibody 50ug 597 € MBS Polyclonals_1 human
EKU03923 Ephrin A5 (EFNA5) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GENTAUR-58b9ffc85a704 Mouse Ephrin-A5 (Efna5) 100ug 1580 € MBS Recombinant Proteins mouse
GENTAUR-58b9ffc8b7336 Mouse Ephrin-A5 (Efna5) 1000ug 1580 € MBS Recombinant Proteins mouse
GENTAUR-58b9ffc92a3bc Mouse Ephrin-A5 (Efna5) 100ug 2083 € MBS Recombinant Proteins mouse
GENTAUR-58b9ffc9b14c3 Mouse Ephrin-A5 (Efna5) 1000ug 2083 € MBS Recombinant Proteins mouse
PR27093-5 anti-Ephrin-A1 Ephrin-A1 / EFNA1 Antibody 5 Вµg 645 € acr human
AP06387PU-N anti-Ephrin-B1 (+Ephrin-B2) Antibody 0,1 mg 558 € acr human
MBS615633 Ephrin B1 (Ephrin-B1, ELK-L, EFL-3, Cek5-L, LERK-2) Antibody 100ug 663 € MBS Polyclonals_1 human
MBS611262 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
MBS614848 Ephrin B2 (EPH-related receptor tyrosine kinase ligand 5, Ephrin-B2, EFNB2, EPLG5, HTK-L, HTK ligand, LERK5) Antibody 100ug 464 € MBS Polyclonals_1 human
LV145989 EFNA5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 600 € ABM lentivectors human
LV145990 EFNA5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 600 € ABM lentivectors human
LV145991 EFNA5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV145992 EFNA5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 600 € ABM lentivectors human
LV145994 EFNA5 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 600 € ABM lentivectors human
LV145993 EFNA5 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 600 € ABM lentivectors human
GWB-ASD555 Human EFNA5 Antibody bulk Ask price € genways bulk human
A03E0030 anti-EFNA5 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdfbe804a8e Anti- EFNA5 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58bdfbe856f21 Anti- EFNA5 Antibody 0.12 ml 348 € MBS Polyclonals human