Recombinant Human V-Set and Transmembrane Domain-Containing 1, VSTM1 (C-6His)

Contact us
Catalog number: CJ71
Price: 735 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human V-Set and Transmembrane Domain-Containing 1, VSTM1 (C-6His)
Quantity: 100ug
Other quantities: 10 µg 156€ 50 µg 369€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human VSTM1 is produced by our Mammalian expression system and the target gene encoding Tyr17-Thr135 is expressed with a 6His tag at the C-terminus
Molecular Weight: 14, 6 kD
UniProt number: Q6UX27
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: YEDEKKNEKPPKPSLHAWPSSVVEAESNVTLKCQAHSQNVTFVLRKVNDSGYKQEQSSAENEAEFPFTDLKPKDAGRYFCAYKTTASHEWSESSEHLQLVVTDKHDELEAPSMKTDTRTVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: VSTM1 (C-6His), V-Set Transmembrane Domain 1
Short name: VSTM1 (C-6His), Recombinant V-Set Transmembrane Domain- 1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: VSTM1 (C-6His), sapiens V-Set and Transmembrane Domain-Containing 1, recombinant H
Alternative technique: rec
Identity: 29455
Gene: VSTM1 | More about : VSTM1
Long gene name: V-set and transmembrane domain containing 1
Synonyms: UNQ3033
Locus: 19q13, 42
Discovery year: 2006-08-02
GenBank acession: AY358542
Entrez gene record: 284415
Pubmed identfication: 12975309
RefSeq identity: NM_198481
Classification: Immunoglobulin like domain containing
Havana BLAST/BLAT: OTTHUMG00000064906

Related Products :

MBS619211 PR Set7 (SET8, SET Domain Containing 8, SET Domain-containing Protein 8, SET Domain Containing Lysine Methyltransferase 8, SET Domain-containing (Lysine Methyltransferase) 8, SETD8, H4 K20 Specific Histone Methyltransferase, H4-K20-HMTase SETD8, PR/SET Do Antibody 100ul 730 € MBS Polyclonals_1 human
CJ71 Recombinant Human V-Set and Transmembrane Domain-Containing 1, VSTM1 (C-6His) 10 µg 156 € novo human
CI23 Recombinant Human V-Set and Transmembrane Domain-Containing 2A, VSTM2A (C-6His) 500 µg 1613 € novo human
MBS620170 SET7 (SET Domain Containing Protein 7, SET Domain-containing Protein 7, SET7/9, SET9, SETD7, FLJ21193, H3-K4-HMTase, H3 Lysine-4 Specific, Histone H3 K4 Methyltransferase, Histone H3-K4 Methyltransferase, Histone H3 Lysine 4 Specific Methyltransferase, Hi 100ul 785 € MBS Polyclonals_1 human
abx263202 Anti-V-Set and Transmembrane Domain Containing 2 Like Protein (Recombinant) 100 µg 1543 € abbex human
C548 Recombinant Human V-Set and Ig Domain-Containing Protein 2, VSIG2 (C-6His) 10 µg 131 € novo human
C549 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-6His) 10 µg 121 € novo human
CP78 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 1 mg 2283 € novo human
CP79 Recombinant Mouse V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-6His) 500 µg 1613 € novo mouse
MBS621421 Semaphorin 4B (SEMA4B, Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain) (Biotin) 50ug 818 € MBS Polyclonals_1 human
GENTAUR-58bd176257772 Human V-set and transmembrane domain-containing protein 2B (VSTM2B) 100ug 1702 € MBS Recombinant Proteins human
GENTAUR-58bd1762b1c1d Human V-set and transmembrane domain-containing protein 2B (VSTM2B) 1000ug 1702 € MBS Recombinant Proteins human
GENTAUR-58bd1762ee6a0 Human V-set and transmembrane domain-containing protein 2B (VSTM2B) 100ug 2216 € MBS Recombinant Proteins human
GENTAUR-58bd17633235c Human V-set and transmembrane domain-containing protein 2B (VSTM2B) 1000ug 2216 € MBS Recombinant Proteins human
MBS619444 FBXW7 (F-box and WD 40 Domain Protein 7, F-box and WD-40 Domain Protein 7, F-box and WD-40 Domain-containing Protein 7, F-box Protein FBW7, F-box/WD Repeat Protein 7, F-box/WD-repeat Protein 7, FBW7, Archipelago Drosophila Homolog of, Archipelago Homolog, Antibody 100ul 785 € MBS Polyclonals_1 drosophila
RP-1640H Recombinant Human VSTM1 Protein (Fc Tag) 20μg 456 € adv human
RP-1641H Recombinant Human VSTM1 Protein (His Tag) 20μg 456 € adv human
MBS620347 SLP-76, NT (SH2 Domain Containing Leukocyte Protein 76 kD, SH2 Domain-containing Leukocyte Protein of 76kD, SH2 Domain Containing Leukocyte Protein of 76kDa, SLP76, SLP76 Tyrosine Phosphoprotein, SLP-76 Tyrosine Phosphoprotein, 76kD Tyrosine Phosphoprotei 100ug 763 € MBS Polyclonals_1 human
LV356345 VSTM1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
MBS615326 ARFBP1 (HUWE1. HECT, UBA and WWE domain containing 1, ARF-binding protein 1, ARF-BP1, E3 ubiquitin-protein ligase HUWE1, HECT, UBA and WWE domain-containing protein 1, HectH9, HECTH9, Homologous to E6AP carboxyl terminus homologous protein 9, HSPC272, Ib7 Antibody 100ug 569 € MBS Polyclonals_1 human
MBS614185 CLAN (CARD 12, CARD LRR and NACHT containing protein 1, CARD LRR and NACHT containing protein, Caspase recruitment domain containing protein 12, CLAN 1, CLAN A, CLAN, CLAN B, CLAN C, CLAN D, Clan protein, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR 2.1, CLR2.1 Antibody 100ug 575 € MBS Polyclonals_1 human
MBS623954 SETDB1, CT (Histone H3-K9 Methyltransferase 4, H3-K9-HMTase 4, SET Domain Bifurcated 1, ERG-associated Protein with SET Domain, Histone-lysine N-methyltransferase SETDB1, Lysine N-methyltransferase 1E, ESET, KIAA0067, KMT1E) 200ul 603 € MBS Polyclonals_1 human
MBS619689 Osteoactivin (Glycoprotein (transmembrane) nmb, Gpnmb, Dchil, DC-HIL, Dendritic cell-associated transmembrane protein, ipd, Nmb, Osteoactivin, Transmembrane glycoprotein NMB) 100ul 1199 € MBS Polyclonals_1 human
MBS619465 Transmembrane Trafficking Protein 21kD (21kD Transmembrane Trafficking Protein, TMP21, Tmp 21-I, Tmp21-I, Tmp-21-I, Transmembrane Protein Tmp21, 1110014C03Rik, MGC102351, p23, p24delta, p24delta1, S31I125, S31III125, Transmembrane emp24 Domain-containing Antibody 100ul 597 € MBS Polyclonals_1 human
abx939573 Anti-VSTM1 siRNA inquire 50 € abbex human
CD69 Recombinant Human V-Set and Ig Domain-Containing Protein 4, VSIG4, CRIg (C-Fc) 50 µg 263 € novo human
CB41 Recombinant Human V-Set and Ig Domain-Containing Protein 8, VSIG8 (C-Fc) 10 µg 156 € novo human
CH34 Recombinant Human Zinc Finger and BTB Domain-Containing Protein 9, ZBTB9 (C-6His) 10 µg 202 € novo human
CA49 Recombinant Human Secreted and Transmembrane Protein 1, SECTM1, CD7L, K12 (C-6His) 1 mg 1674 € novo human
MBS622108 GIPC3 (GIPC PDZ Domain Containing Family Member 3, PDZ Domain-containing Protein GIPC3, PDZ Domain Protein GIPC3) Antibody 100ug 735 € MBS Polyclonals_1 human