Recombinant Human Tissue Inhibitor of Metalloproteinases 4, TIMP-4 (C-6His)

Contact us
Catalog number: CJ60
Price: 360 €
Supplier: abebio
Product name: Recombinant Human Tissue Inhibitor of Metalloproteinases 4, TIMP-4 (C-6His)
Quantity: 1x plate of 48 wells
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Not all receptor antagonist that bind to enzymes are inhibitors, Since blocking an enzyme's activity can kill a pathogen , activator, caspase, esterase inhibitors , lipoprotein, many drugs are enzyme inhibitors, papain, pathway, peptidase, protease , proteinase, trypsin, while enzyme substrates bind and are converted to products in the normal catalytic cycle of the enzyme,  , Tissue, acrosin, activity, and decreases its , are , bind to enzymes and increase their , enzymatic activity, enzyme activator ligands or agonists , enzyme receptor , imbalance, metabolic , or correct a , or receptor ligands or receptor antagonists that bind to an , proteins 
Molecular Weight: 23, 5 kD
UniProt number: Q99727
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: CSCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQPVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: TIMP-4 (C-6His), Tissue Inhibitor of Metalloproteinases 4
Short name: TIMP-4 (C-6His), Recombinant Tissue Inhibitor of Metalloproteinases 4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: TIMP-4 (C-6His), sapiens Tissue suppressor on Metalloproteinases 4, recombinant H
Alternative technique: rec

Related Products :

C456 Recombinant Human Tissue Inhibitor of Metalloproteinases 1, TIMP-1 (C-6His) 1 mg 2283 € novo human
C459 Recombinant Human Tissue Inhibitor of Metalloproteinases 2, TIMP-2 (C-6His) 500 µg 1613 € novo human
CJ60 Recombinant Human Tissue Inhibitor of Metalloproteinases 4, TIMP-4 (C-6His) 500 µg 1613 € novo human
CC68 Recombinant Mouse Tissue Inhibitor of Metalloproteinases 2, TIMP-2 (C-6His) 500 µg 1613 € novo mouse
CM11 Recombinant Mouse Tissue Inhibitors of Metalloproteinases 1, TIMP1 1 mg 2486 € novo mouse
MEDCLA497 TIMP-1 (Tissue Inhibitor of MMP-1) (NO X w/TIMP2), Clone: 2A5, Mouse Monoclonal antibody-Human, paraffin, IH 1000ul Ask price € accurate-monoclonals human
BMDV10143 TIMP-1 (Tissue Inhibitor of MMP's), 28.5kD, Clone: 102B1, Mouse Monoclonal antibody-Human, Rat; WB 500ul 887 € accurate-monoclonals rat
YMCAF2600 TIMP-1 (Tissue Inhibitor of MMP's), Clone: 147-6D11, Mouse Monoclonal antibody-Human; paraffin, IH/WB 1 mg 2670 € accurate-monoclonals human
YMCAF2650 TIMP-1 (Tissue Inhibitor of MMP's), Clone: 147-6D11, Mouse Monoclonal antibody-Human; paraffin, IH/WB 0.5mg 1620 € accurate-monoclonals human
YMCAF2300 TIMP-1 (Tissue Inhibitor of MMP's), Clone: 7-6C1, Mouse Monoclonal antibody-Bovine, Human; paraffin, IH/WB 1 mg 1999 € accurate-monoclonals human
YMCAF2350 TIMP-1 (Tissue Inhibitor of MMP's), Clone: 7-6C1, Mouse Monoclonal antibody-Bovine, Human; paraffin, IH/WB 0.5mg 1223 € accurate-monoclonals human
MEDCLA498 TIMP-2 (Tissue Inhibitor of MMP-2) (NO X w/TIMP1), Clone: 3A4, Mouse Monoclonal antibody-Human, paraffin, IH 1000ul 1055 € accurate-monoclonals human
BMDV10144 TIMP-2 (Tissue Inhibitor of MMP's), 21kD, Clone: T2-101, Mouse Monoclonal antibody-Human, NO X w/Mouse or Rat; WB?IP (native & denatured) 500ul 887 € accurate-monoclonals rat
YMCAF7000 TIMP-2 (Tissue Inhibitor of MMP's), Clone: 67-4H11, Mouse Monoclonal antibody-Human, Mouse, Rat, Rabbit, Bovine, G pig; frozen/paraffin, IH/WB 1 mg 5110 € accurate-monoclonals bovine
YMCAF7050 TIMP-2 (Tissue Inhibitor of MMP's), Clone: 67-4H11, Mouse Monoclonal antibody-Human, Mouse, Rat, Rabbit, Bovine, G pig; frozen/paraffin, IH/WB 0.5mg 3088 € accurate-monoclonals bovine
YSRTMCA1668 TIMP-2 (Tissue Inhibitor of MMP's), Clone: T2-101, Mouse Monoclonal antibody-Human; frozen, IH/IP/WB 0.1 mg Ask price € accurate-monoclonals human
YMCAF8500 TIMP-3 (Tissue Inhibitor of MMP's), residue 170-188, Clone: 136-13H4, Mouse Monoclonal antibody-Human, Rabbit; paraffin, IH/WB 1 mg 6794 € accurate-monoclonals human
YMCAF8550 TIMP-3 (Tissue Inhibitor of MMP's), residue 170-188, Clone: 136-13H4, Mouse Monoclonal antibody-Human, Rabbit; paraffin, IH/WB 0.5mg 4100 € accurate-monoclonals human
GENTAUR-58be1fddb9d1b Tissue Inhibitor of Matrix Metalloproteinase 1 (TIMP-1) 200ug 387 € MBS mono human
GENTAUR-58be1fdd5bf18 Tissue Inhibitor of Matrix Metalloproteinase 1 (TIMP-1) Antibody 200ug 387 € MBS mono human
C390 Recombinant Human Tissue Factor Pathway Inhibitor 2, TFPI-2, PP5, REF-1 (C-6His) 10 µg 202 € novo human
AE14942HU-48 ELISA test for Human Tissue inhibitors of metalloproteinase 4 (TIMP-4) 1x plate of 48 wells 352 € abebio human
AE14942HU Human Tissue inhibitors of metalloproteinase 4 (TIMP-4) ELISA Kit 48 wells plate 455 € ab-elisa elisas human
AE14942HU-96 Human Tissue inhibitors of metalloproteinase 4 (TIMP-4) ELISA Kit 1x plate of 96 wells 570 € abebio human
E-EL-C0056 Canine TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0324 Chicken TIMP-1 (Tissue Inhibitors of Metalloproteinase 1) ELISA Kit 96T 497 € elabsciences chicken
E-EL-Ch0153 Chicken TIMP-3 (Tissue Inhibitors of Metalloproteinase 3) ELISA Kit 96T 497 € elabsciences chicken
AE14964HO-48 ELISA test for Horse Tissue inhibitors of metalloproteinase 1 (TIMP-1) 1x plate of 48 wells 402 € abebio horse
AE14961MO-48 ELISA test for Mouse Tissue inhibitors of metalloproteinase 1 (TIMP-1) 1x plate of 48 wells 360 € abebio mouse
AE14959RA-48 ELISA test for Rat Tissue inhibitors of metalloproteinase 1 (TIMP-1) 1x plate of 48 wells 360 € abebio rat