Recombinant Human Hematopoietic Lineage Cell-Specific Protein, HCLS1 (C-6His)

Contact us
Catalog number: CJ33
Price: Ask price €
Supplier: accurate-monoclonals
Product name: Recombinant Human Hematopoietic Lineage Cell-Specific Protein, HCLS1 (C-6His)
Quantity: vial
Other quantities: 1 mg 2486€ 10 µg 202€ 50 µg 496€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Hematopoietic lineage cell-specific protein is produced by our Mammalian expression system and the target gene encoding Met1-Glu486 is expressed with a 6His tag at the C-terminus
Molecular Weight: 55 kD
UniProt number: P14317
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MWKSVVGHDVSVSVETQGDDWDTDPDFVNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGPKASHGYGGRFGVERDRMDKSAVGHEYVAEVEKHSSQTDAAKGFGGKYGVERDRADKSAVGFDYKGEVEKHTSQKDYSRGFGGRYGVEKDKWDKAALGYDYKGETEKHESQRDYAKGFGGQYGIQKDRVDKSAVGFNEMEAPTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVEEEPVYEAEPEPEPEPEPEPENDYEDVEEMDRHEQEDEPEGDYEEVLEPEDSSFSSALAGSSGCPAVDHHHHHHGAGAGAVALGISAVAVYDYQGEGSDELSFDPDDVITDIEMVDEGWWRGRCHGHFGLFPANYVKLLE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HCLS1 (C-6His), Hematopoietic Lineage Specific Protein
Short name: HCLS1 (C-6His), Recombinant Hematopoietic Lineage Cell-Specific Protein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: HCLS1 (C-6His), sapiens Hematopoietic Lineage cellular-Specific Protein, recombinant H
Alternative technique: rec
Identity: 4844
Gene: HCLS1 | More about : HCLS1
Long gene name: hematopoietic cell-specific Lyn substrate 1
Synonyms: HS1 CTTNL
Synonyms name: cortactin-like
Locus: 3q13, 33
Discovery year: 1995-09-26
Entrez gene record: 3059
Pubmed identfication: 8978766 15710041
RefSeq identity: NM_005335
Havana BLAST/BLAT: OTTHUMG00000159409

Related Products :

CJ33 Recombinant Human Hematopoietic Lineage Cell-Specific Protein, HCLS1 (C-6His) 50 µg 496 € novo human
MBS619237 HCLS1 associated protein X-1 (HAX1, FLJ17042, FLJ18492, FLJ93803, HAX-1, HCLS1-associated Protein X-1, HCLSBP1, HS1-associating Protein X-1, HS1-binding Protein 1, HS1BP1, SCN3) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS610051 Pax5 (Paired Box 5, Paired Box Homeotic Gene 5, Pax-5, B cell Lineage Specific Activator Protein, B cell Specific Transcription Factor, BSAP) 100ug 735 € MBS Polyclonals_1 human
MBS613763 Pax5 (Paired Box 5, Paired Box Homeotic Gene 5, Pax-5, B cell Lineage Specific Activator Protein, B cell Specific Transcription Factor, BSAP) 0.25 ml 409 € MBS Polyclonals_1 human
MBS615238 Pax5 (Paired Box 5, Paired Box Homeotic Gene 5, Pax-5, B cell Lineage Specific Activator Protein, B cell Specific Transcription Factor, BSAP) 500ul 669 € MBS Polyclonals_1 human
CBL512 CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: 143-30, Mouse Monoclonal antibody-Human 200ug 514 € accurate-monoclonals human
OBT1089 CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: 143-30, Mouse Monoclonal antibody-Human 200ug Ask price € accurate-monoclonals human
YSRTMCA1614 CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: 67, Mouse Monoclonal antibody-Human; flow 200ug 489 € accurate-monoclonals human
YSRTMCA1614T CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: 67, Mouse Monoclonal antibody-Human; flow 25 ug 119 € accurate-monoclonals human
YSRTMCA1614PE CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: 67, Mouse Monoclonal antibody-Human, RPE; flow vial 432 € accurate-monoclonals human
YSRTMCA1614PET CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: 67, Mouse Monoclonal antibody-Human, RPE; flow vial 177 € accurate-monoclonals human
MAS665p CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: BRIC-216, Mouse Monoclonal antibody-Human 0.25 mg Ask price € accurate-monoclonals human
OBT3248 CD55, Decay Accelarating Factor, Hematopoietic & non-hematopoietic Cell, Clone: BRIC-216, Mouse Monoclonal antibody-Human 200ug Ask price € accurate-monoclonals human
CLBM2156 CD55, Decay Accelarating Factor, Hematopoietic & non-Hematopoietic Cell, gp 70, Clone: BRIC 110, Mouse Monoclonal antibody-Human 1000ul 809 € accurate-monoclonals human
CLBM2157 CD58, LFA-3, Hematopoietic & non-Hematopoietic Cell, gp55-70, Clone: BRIC 5, Mouse Monoclonal antibody-Human 1000ul 809 € accurate-monoclonals human
YSRTMCA1054GA CD59, MAC Inhibitor, Hematopoietic and non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human 0.1 mg 233 € accurate-monoclonals human
YSRTMCA1054XZ CD59, MAC Inhibitor, Hematopoietic and non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human, azide-free 1 mg 1030 € accurate-monoclonals human
YSRTMCA1054B CD59, MAC Inhibitor, Hematopoietic and non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human, Biotin 0.1 mg 462 € accurate-monoclonals human
YSRTMCA1054BT CD59, MAC Inhibitor, Hematopoietic and non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human, Biotin 25 ug 177 € accurate-monoclonals human
CLBM2121 CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human 1000ul 809 € accurate-monoclonals human
CLBM2191 CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human, FITC 1000ul 809 € accurate-monoclonals human
YSRTMCA1054PE CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human, RPE; flow vial 462 € accurate-monoclonals human
YSRTMCA1054PET CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-Human, RPE; flow vial 177 € accurate-monoclonals human
YSRTMCA715F CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: YTH53.1, Rat Mouse Monoclonal antibody-Human, FITC; flow vial 617 € accurate-monoclonals human
YSRTMCA715 CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: YTH53.1, Rat Mouse Monoclonal antibody-Human; frozen, IH/flw vial Ask price € accurate-monoclonals human
YSRTMCA715G CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: YTH53.1, Rat Mouse Monoclonal antibody-Human; frozen, IH/flw 200ug 462 € accurate-monoclonals human
YSRTMCA715GT CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: YTH53.1, Rat Mouse Monoclonal antibody-Human; frozen, IH/flw 25 ug 119 € accurate-monoclonals human
YSRTMCA715PE CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: YTH53.1, Rat Mouse Monoclonal antibody-Human, RPE; flow vial 432 € accurate-monoclonals human
YSRTMCA715PET CD59, MAC Inhibitor, Hematopoietic/non-Hematopoietic Cell, gp18-20, Clone: YTH53.1, Rat Mouse Monoclonal antibody-Human, RPE; flow vial 177 € accurate-monoclonals human
YSRTMCA1054A647 CD59, MAC Inhibitor, Hematopoietic and non-Hematopoietic Cell, gp18-20, Clone: MEM 43, Mouse Monoclonal antibody-, ALEXA 647 conj. vial Ask price € accurate-monoclonals mouse