Recombinant Human Plasma Kallikrein, KLKB1 (C-6His)

Contact us
Catalog number: CJ20
Price: 285 €
Supplier: genways
Product name: Recombinant Human Plasma Kallikrein, KLKB1 (C-6His)
Quantity: 1 x 1 vial
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Plasma kallikrein is produced by our Mammalian expression system and the target gene encoding Gly20-Ala638 is expressed with a 6His tag at the C-terminus
Molecular Weight: 2 kD, 70
UniProt number: P03952
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 10% Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILNLSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCWVTGWGFSKEKGEIQNILQKVNIPLVTNEECQKRYQDYKITQRMVCAGYKEGGKDACKGDSGGPLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWILEKTQSSDGKAQMQSPAVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: KLKB1 (C-6His), Plasma Kallikrein
Short name: KLKB1 (C-6His), Recombinant Plasma Kallikrein
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: KLKB1 (C-6His), sapiens Plasma Kallikrein, recombinant H
Alternative technique: rec
Identity: 6371
Gene: KLKB1 | More about : KLKB1
Long gene name: kallikrein B1
Synonyms gene: KLK3
Synonyms gene name: kallikrein B, plasma (Fletcher factor) 1
Synonyms name: Fletcher factor
Locus: 4q35, 2
Discovery year: 1999-04-23
GenBank acession: M13143
Entrez gene record: 3818
Pubmed identfication: 9535413 3521732
RefSeq identity: NM_000892
Classification: Kallikreins
Havana BLAST/BLAT: OTTHUMG00000150347

Related Products :

CJ20 Recombinant Human Plasma Kallikrein, KLKB1 (C-6His) 500 µg 1613 € novo human
AE36468HU-48 ELISA test for Human Plasma kallikrein (KLKB1) 1x plate of 48 wells 373 € abebio human
AE36468HU Human Plasma kallikrein (KLKB1) ELISA Kit 96 wells plate 769 € ab-elisa elisas human
AE36468HU-96 Human Plasma kallikrein (KLKB1) ELISA Kit 1x plate of 96 wells 612 € abebio human
MBS242660 Sheep Polyclonal (IgG) to Human KLKB1 / Plasma Kallikrein Antibody 50ug 597 € MBS Polyclonals_1 human
PSA20-R-10 Recombinant (HEK) Human Prostate Specific Antigen (PSA/KLKB1/Kallikrein-3/KLK3) protein (His-tag, >95%, low endotoxin, active) 10 μg 333 € adi human
PSA20-R-50 Recombinant (HEK) Human Prostate Specific Antigen (PSA/KLKB1/Kallikrein-3/KLK3) protein (His-tag, >95%, low endotoxin, active) 50 μg 1058 € adi human
MBS619101 KLK1B27 (Klk1b27, kallikrein 1-related peptidase b27, Gk27, Klk27, mGK-27, glandular kallikrein 27, kallikrein 27) Antibody 100ug 509 € MBS Polyclonals_1 human
C481 Recombinant Human Kallikrein 1, KLK1 (C-6His) 10 µg 202 € novo human
C360 Recombinant Human Kallikrein 10, KLK10 (C-6His) 50 µg 496 € novo human
C361 Recombinant Human Kallikrein 11, KLK11 (C-6His) 1 mg 2283 € novo human
C362 Recombinant Human Kallikrein 13, KLK13 (C-6His) 50 µg 496 € novo human
C616 Recombinant Human Kallikrein 2, KLK2 (C-6His) 50 µg 496 € novo human
C363 Recombinant Human Kallikrein 4, KLK4 (C-6His) 1 mg 2283 € novo human
C415 Recombinant Human Kallikrein 5, KLK5 (C-6His) 50 µg 496 € novo human
C366 Recombinant Human Kallikrein 6, KLK6, Neurosin (C-6His) 10 µg 202 € novo human
C364 Recombinant Human Kallikrein 7, KLK7, SCEE (C-6His 1 mg 2283 € novo human
C367 Recombinant Human Kallikrein 8, Neuropsin (C-6His) 1 mg 2283 € novo human
MBS224135 Anti-HUMAN PLASMA KALLIKREIN Antibody 1 mililiter 370 € MBS Polyclonals_1 human
KAL15-N-50 Kallikrein, Human Plasma 50 μg 333 € adi human
KAL11-A Rabbit Anti-Human Plasma Kallikrein IgG 100 μL 478 € adi human
CK86 Recombinant Mouse Kallikrein 7, KLK7 (C-6His) 50 µg 496 € novo mouse
CJ09 Recombinant Mouse Plasma Glutamate Carboxypeptidase, PGCP (C-6His) 500 µg 1613 € novo mouse
MBS610873 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1 mililiter 470 € MBS Polyclonals_1 human
MBS612293 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) 1000ug 641 € MBS Polyclonals_1 human
MBS618778 Prostate Speci?c Antigen (PSA, Kallikrein-3, Kallikrein III, Seminin, Semenogelase, gamma-Seminoprotein, P-30 antigen, KLK3) Antibody 1 mililiter 470 € MBS Polyclonals_1 human
abx141274 Anti-Plasma Kallikrein HC Antibody 30 μl 253 € abbex human
MBS270734 Plasma Kallikrein 1B antibody 100ul 426 € MBS Polyclonals_1 human
GWB-AA5D67 PLASMA Kallikrein antibody 1 vial 434 € genways human
GWB-1848B4 Purified Plasma Kallikrein 1 x 1 vial 285 € genways human