| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human PLA2G1B is produced by our Mammalian expression system and the target gene encoding Ala23-Ser148 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
15, 2 kD |
| UniProt number: |
P04054 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
10% Glycerol, 150 mM sodium chloride, 2 um filtered solution of 20 mM TrisHCl, Supplied as a 0, pH8 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQSVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PLA2, PLA2A (C-6His), PLA2G1B |
| Short name: |
PLA2, PLA2A (C-6His), Recombinant PLA2G1B |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
PLA2, PLA2A (C-6His), family IB (pancreas), sapiens phospholipase A2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, PLA2 and PLA2A and PPLA2, PLA2G1B and IDBG-60467 and ENSG00000170890 and 5319, PLA2G1B and IDBG-634759 and ENSBTAG00000026732 and 282457, Pla2g1b and IDBG-193845 and ENSMUSG00000029522 and 18778, calcium-dependent phospholipase A2 activity, group IB (pancreas), this GO :0000187 and activation of MAPK activity and biological process this GO :0002227 and innate immune response in mucosa and biological process this GO :0002446 and neutrophil mediated immunity and biological process this GO :0004623 and phospholipase A2 activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0006633 and fatty acid biosynthetic process and biological process this GO :0006644 and phospholipid metabolic process and biological process this GO :0006654 and phosphatidic acid biosynthetic process and biological process this GO :0007015 and actin filament organization and biological process this GO :0007165 and signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0010524 and positive regulation of calcium ion transport into cytosol and biological process this GO :0015758 and glucose transport and biological process this GO :0016042 and lipid catabolic process and biological process this GO :0019370 and leukotriene biosynthetic process and biological process this GO :0019731 and antibacterial humoral response and biological process this GO :0030141 and secretory granule and cellular component this GO :0030593 and neutrophil chemotaxis and biological process this GO :0032052 and bile acid binding and molecular function this GO :0032431 and activation of phospholipase A2 activity and biological process this GO :0032637 and interleukin-8 production and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0035556 and intracellular signal transduction and biological process this GO :0036148 and phosphatidylglycerol acyl-chain remodeling and biological process this GO :0036149 and phosphatidylinositol acyl-chain remodeling and biological process this GO :0036150 and phosphatidylserine acyl-chain remodeling and biological process this GO :0036151 and phosphatidylcholine acyl-chain remodeling and biological process this GO :0036152 and phosphatidylethanolamine acyl-chain remodeling and biological process this GO :0044240 and multicellular organismal lipid catabolic process and biological process this GO :0044281 and small molecule metabolic process and biological process this GO :0045740 and positive regulation of DNA replication and biological process this GO :0045944 and positive regulation of transcription from RNA polymerase II promoter and biological process this GO :0046470 and phosphatidylcholine metabolic process and biological process this GO :0046474 and glycerophospholipid biosynthetic process and biological process this GO :0047498 and calcium-dependent phospholipase A2 activity and molecular function this GO :0048146 and positive regulation of fibroblast proliferation and biological process this GO :0050482 and arachidonic acid secretion and biological process this GO :0050714 and positive regulation of protein secretion and biological process this GO :0050778 and positive regulation of immune response and biological process this GO :0050830 and defense response to Gram-positive bacterium and biological process this GO :0051092 and positive regulation of NF-kappaB transcription factor activity and biological process, this GO :0004623 : phospholipase A2 activity, this GO :0004623 : phospholipase A2 activity and also this GO :0005102 : receptor binding and also this GO :0005509 : calcium ion binding and also this GO :0032052 : bile acid binding and also this GO :0047498 : calcium-dependent phospholipase A2 activity, this GO :0005102 : receptor binding, this GO :0005509 : calcium ion binding, this GO :0032052 : bile acid binding, this GO :0047498 : calcium-dependent phospholipase A2 activity, phospholipase A2 |
| Identity: |
9030 |
| Gene: |
PLA2G1B |
More about : PLA2G1B |
| Long gene name: |
phospholipase A2 group IB |
| Synonyms gene: |
PLA2 PPLA2 PLA2A |
| Synonyms gene name: |
group IB (pancreas) , phospholipase A2 |
| Locus: |
12q24, 31 |
| Discovery year: |
1986-01-01 |
| Entrez gene record: |
5319 |
| Pubmed identfication: |
8175726 |
| Classification: |
Phospholipases |
| Havana BLAST/BLAT: |
OTTHUMG00000169343 |