| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Tyrosine-protein kinase Mer is produced by our Mammalian expression system and the target gene encoding Met177-Ala499 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
36 kD |
| UniProt number: |
Q12866 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0, pH8 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MKINNEEIVSDPIYIEVQGLPHFTKQPESMNVTRNTAFNLTCQAVGPPEPVNIFWVQNSSRVNEQPEKSPSVLTVPGLTEMAVFSCEAHNDKGLTVSKGVQINIKAIPSPPTEVSIRNSTAHSILISWVPGFDGYSPFRNCSIQVKEADPLSNGSVMIFNTSALPHLYQIKQLQALANYSIGVSCMNEIGWSAVSPWILASTTEGAPSVAPLNVTVFLNESSDNVDIRWMKPPTKQQDGELVGYRISHVWQSAGISKELLEEVGQNGSRARISVQVHNATCTVRIAAVTKGGVGPFSDPVKIFIPAHGWVDYAPSSTPAPGNAVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
MER (C-6His), MERTK, Receptor Tyrosine Kinase MerTK |
| Short name: |
MER (C-6His), MERTK, Recombinant Receptor Tyrosine Kinase MerTK |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
MER (C-6His), c-mer proto-oncogene tyrosine kinase, sapiens Receptor Tyrosine phosphorylation catalyst c-mer proto-oncogene tyrosine kinase, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, MERTK and IDBG-628865 and ENSBTAG00000005828 and 504429, MERTK and IDBG-66030 and ENSG00000153208 and 10461, Mertk and IDBG-205458 and ENSMUSG00000014361 and 17289, c-mer and MER and RP38, this GO :0001750 and photoreceptor outer segment and cellular component this GO :0001779 and natural killer cell differentiation and biological process this GO :0004672 and protein kinase activity and molecular function this GO :0004713 and protein tyrosine kinase activity and molecular function this GO :0004714 and transmembrane receptor protein tyrosine kinase activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005524 and ATP binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006468 and protein phosphorylation and biological process this GO :0006909 and pha this GO cytosis and biological process this GO :0007166 and cell surface receptor signaling pathway and biological process this GO :0007267 and cell-cell signaling and biological process this GO :0007283 and spermatogenesis and biological process this GO :0007596 and blood coagulation and biological process this GO :0016021 and integral component of membrane and cellular component this GO :0016028 and rhabdomere and cellular component this GO :0016772 and transferase activity, this GO :0004672 : protein kinase activity, this GO :0004672 : protein kinase activity and also this GO :0004713 : protein tyrosine kinase activity and also this GO :0004714 : transmembrane receptor protein tyrosine kinase activity and also this GO :0005515 : protein binding and also this GO :0005524 : ATP binding and also this GO :0016772 : transferase activity, this GO :0004713 : protein tyrosine kinase activity, this GO :0004714 : transmembrane receptor protein tyrosine kinase activity, this GO :0005515 : protein binding, this GO :0005524 : ATP binding, this GO :0016772 : transferase activity, transferase activity, transferring phosphorus-containing groups, transferring phosphorus-containing groups, transferring phosphorus-containing groups and molecular function this GO :0018108 and peptidyl-tyrosine phosphorylation and biological process this GO :0030168 and platelet activation and biological process this GO :0032940 and secretion by cell and biological process this GO :0034446 and substrate adhesion-dependent cell spreading and biological process this GO :0043277 and apoptotic cell clearance and biological process this GO :0043491 and protein kinase B signaling and biological process this GO :0045087 and innate immune response and biological process this GO :0050766 and positive regulation of pha this GO cytosis and biological process this GO :0050900 and leukocyte migration and biological process this GO :0051250 and negative regulation of lymphocyte activation and biological process this GO :0060041 and retina development in camera-type eye and biological process this GO :0060068 and vagina development and biological process, c-mer proto-oncogene tyrosine kinase |
| Identity: |
7027 |
| Gene: |
MERTK |
More about : MERTK |
| Long gene name: |
MER proto-oncogene, tyrosine kinase |
| Synonyms gene name: |
c-mer proto-oncogene tyrosine kinase |
| Synonyms: |
mer RP38 c-Eyk Tyro12 |
| Locus: |
2q13 |
| Discovery year: |
1998-11-30 |
| GenBank acession: |
U08023 |
| Entrez gene record: |
10461 |
| Pubmed identfication: |
8086340 10343112 |
| Classification: |
I-set domain containing Immunoglobulin like domain containing Fibronectin type III domain containing Receptor Tyrosine Kinases |
| Havana BLAST/BLAT: |
OTTHUMG00000131278 |
| Locus Specific Databases: |
Mutations of the MER Receptor Tyrosine Kinase Gene |