Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells)

Contact us
Catalog number: CI89
Price: 303 €
Supplier: novo
Product name: Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Mouse
Source: proteins, Recombinants or rec
Description: Recombinant Mouse Adiponectin is produced by our Mammalian expression system and the target gene encoding Glu18-Asn247 is expressed with a 6His tag at the C-terminus
Molecular Weight: 27, 6 kD
UniProt number: Q60994
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTNHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Test: A/J, BALB/c, Mouse are mature after 40 days for females and 55 days for males, SCID while the CD-1 is outbred as strain, The female mice are pregnant only 20 days and can give birth to 10 litters of 6-8 mice a year, Transgenic, congenic and inbread strains are known for C57BL/6, knock-out, Mouse , mice from the Mus musculus species are used for production of mouse monoclonal antibodies or mabs and as research model for humans in your lab, or 
Latin name: Mus musculus
Group: recombinants
Gene target: Acrp30, AdipoQ (C-6His, Cells), Adiponectin
Short name: Acrp30, AdipoQ (C-6His, Cells), Recombinant Mouse Adiponectin
Technique: E, coli recombinant proteins are , mouses, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Mouses, Human
Alternative name: Acrp30, C1Q and collagen domain containing (C-6His, H, adiponectin, sapiens Cells), recombinant Mouse Adiponectin
Alternative technique: rec

Related Products :

CI89 Recombinant Mouse Adiponectin, Acrp30, AdipoQ (C-6His, Human Cells) 500 µg 1613 € novo human
CH26 Recombinant Mouse Adiponectin, Acrp30, AdipoQ ((N-6His, E. coli) 10 µg 146 € novo e-coli
C552 Recombinant Human Adiponectin, ACRP30, ADIPOQ (C-6His) 1 mg 2283 € novo human
ACRP310-TR-10 Mouse recombinant (HEK) purified Acrp30/Adiponectin protein, Trimeric 10 μg 478 € adi mouse
ACRP310-TR-5 Mouse recombinant (HEK) purified Acrp30/Adiponectin protein, Trimeric 5 μg 333 € adi mouse
RP-1815H Recombinant Human ADIPOQ /Adiponectin Protein 100ug 642 € adv human
103-M214 Anti-Mouse Adiponectin (Acrp30) 100ug 336 € Reliatech antibodies mouse
101-M212 Anti-Human Adiponectin (ACRP30) 100ug 336 € Reliatech antibodies human
GWB-AE3F42 Adiponectin C1Q And Collagen Domain Containing (ADIPOQ) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GENTAUR-58bd58a62625a Human Adiponectin (ADIPOQ) 100ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bd58a67ebe5 Human Adiponectin (ADIPOQ) 1000ug 1680 € MBS Recombinant Proteins human
GENTAUR-58bd58a6d23bc Human Adiponectin (ADIPOQ) 100ug 2194 € MBS Recombinant Proteins human
GENTAUR-58bd58a71c926 Human Adiponectin (ADIPOQ) 1000ug 2194 € MBS Recombinant Proteins human
ZP-3551 Adiponectin / ACRP30 Peptide 0.05 mg 204 € Zyagen human
XA-1016 anti-ACRP30 / Adiponectin Antibody [Ne.Na] 0.1 mg 180 € proscience human
E-EL-C0012 Canine ADP/Acrp30 (Adiponectin) ELISA Kit 96T 624 € elabsciences human
E-EL-Ch0060 Chicken ADP/Acrp30 (Adiponectin) ELISA Kit 96T 497 € elabsciences chicken
AE23984HA-48 ELISA test for Hamster adiponectin, C1Q and collagen domain containing (ADIPOQ) 1x plate of 48 wells 402 € abebio hamster
AE23984HA-96 Hamster adiponectin, C1Q and collagen domain containing (ADIPOQ) ELISA Kit 1x plate of 96 wells 671 € abebio hamster
GENTAUR-58be254011c8a anti-CD45 RA B-cells, T-cells, NK-cells 1000ug 1028 € MBS mono human
GENTAUR-58be25408a38d anti-CD45 RA B-cells, T-cells, NK-cells 100ug 304 € MBS mono human
MBS620748 NFAT3 (NF-AT3, Cytoplasmic Nuclear Factor of Activated T cells 4, Nuclear Factor of Activated T cells Cytoplasmic 4, Nuclear Factor of Activated T cells Cytoplasmic Calcineurin Dependent 4, NF-ATc4, NFATc4, Nuclear Factor of Activated T cells, T cell Tran Antibody 100ug 509 € MBS Polyclonals_1 human
ACRP301-C Mouse purified recombinant (E.Coli) Acrp30 protein (a.a 111-247) control for WB 100 μL 333 € adi mouse
ACRP305-R-25 Mouse purified recombinant (E.Coli, his-tag) Acrp30 protein (full length) for ELISA 25 μg 449 € adi mouse
ACRP302-R-10 Human purified, recombinant (E.Coli, his-tag) Acrp30 protein, full length 10 μg 478 € adi human
ACRP302-R-5 Human purified, recombinant (E.Coli, his-tag) Acrp30 protein, full length 5 μg 333 € adi human
ACRP302-C Human purified, recombinant (E.Coli, his-tag) Acrp30 protein (full length) control for WB 100 μL 333 € adi human
ZR-40-326 Acrp30 Recombinant Protein 0.005 mg 256 € Zyagen human
ZR-40-327 Acrp30 Recombinant Protein 0.005 mg 256 € Zyagen human
CM92 Recombinant Mouse Triggering Receptor Expressed on Myeloid Cells 2b, TREM-2b (C-6His) 50 µg 303 € novo mouse