| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Adiponectin is produced by our Mammalian expression system and the target gene encoding Glu19-Asn244 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
25, 58 kD |
| UniProt number: |
Q15848 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
ACRP30, ADIPOQ (C-6His), Adiponectin |
| Short name: |
ACRP30, ADIPOQ (C-6His), Recombinant Adiponectin |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
ACRP30, C1Q and collagen domain containing (C-6His), adiponectin, sapiens Adiponectin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ACDC and ACRP30 and ADIPQTL1 and ADPN and APM-1 and APM1 and GBP28, ADIPOQ and IDBG-634641 and ENSBTAG00000019813 and 282865, ADIPOQ and IDBG-69167 and ENSG00000181092 and 9370, Adipoq and IDBG-149533 and ENSMUSG00000022878 and 11450, C1Q and collagen domain containing, DNA-templated and biological process this GO :0045923 and positive regulation of fatty acid metabolic process and biological process this GO :0046326 and positive regulation of glucose import and biological process this GO :0046888 and negative regulation of hormone secretion and biological process this GO :0048662 and negative regulation of smooth muscle cell proliferation and biological process this GO :0050728 and negative regulation of inflammatory response and biological process this GO :0050731 and positive regulation of peptidyl-tyrosine phosphorylation and biological process this GO :0050765 and negative regulation of pha this GO cytosis and biological process this GO :0050805 and negative regulation of synaptic transmission and biological process this GO :0050873 and brown fat cell differentiation and biological process this GO :0051260 and protein homooli this GO merization and biological process this GO :0051384 and response to glucocorticoid and biological process this GO :0051899 and membrane depolarization and biological process this GO :0060081 and membrane hyperpolarization and biological process this GO :0070062 and extracellular vesicular exosome and cellular component this GO :0070208 and protein heterotrimerization and biological process this GO :0070373 and negative regulation of ERK1 and ERK2 cascade and biological process this GO :0070543 and response to linoleic acid and biological process this GO :0070994 and detection of oxidative stress and biological process this GO :0071320 and cellular response to cAMP and biological process this GO :0071639 and positive regulation of monocyte chemotactic protein-1 production and biological process this GO :0071872 and cellular response to epinephrine stimulus and biological process this GO :0072659 and protein localization to plasma membrane and biological process this GO :0090317 and negative regulation of intracellular protein transport and biological process this GO :1900121 and negative regulation of receptor binding and biological process this GO :2000279 and negative regulation of DNA biosynthetic process and biological process this GO :2000467 and positive regulation of glycogen (starch) synthase activity and biological process this GO :2000478 and positive regulation of metanephric glomerular visceral epithelial cell development and biological process this GO :2000481 and positive regulation of cAMP-dependent protein kinase activity and biological process this GO :2000534 and positive regulation of renal albumin absorption and biological process this GO :2000584 and negative regulation of platelet-derived growth factor receptor-alpha signaling pathway and biological process this GO :2000590 and negative regulation of metanephric mesenchymal cell migration and biological process, Extracellular, protein homodimerization activity, this GO :0001666 and response to hypoxia and biological process this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005179 and hormone activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005581 and collagen trimer and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005783 and endoplasmic reticulum and cellular component this GO :0006006 and glucose metabolic process and biological process this GO :0006091 and generation of precursor metabolites and energy and biological process this GO :0006635 and fatty acid beta-oxidation and biological process this GO :0007584 and response to nutrient and biological process this GO :0007623 and circadian rhythm and biological process this GO :0009744 and response to sucrose stimulus and biological process this GO :0009749 and response to glucose and biological process this GO :0009967 and positive regulation of signal transduction and biological process this GO :0009986 and cell surface and cellular component this GO :0010642 and negative regulation of platelet-derived growth factor receptor signaling pathway and biological process this GO :0010739 and positive regulation of protein kinase A signaling and biological process this GO :0010745 and negative regulation of macrophage derived foam cell differentiation and biological process this GO :0010804 and negative regulation of tumor necrosis factor-mediated signaling pathway and biological process this GO :0010875 and positive regulation of cholesterol efflux and biological process this GO :0010906 and regulation of glucose metabolic process and biological process this GO :0014823 and response to activity and biological process this GO :0014912 and negative regulation of smooth muscle cell migration and biological process this GO :0019395 and fatty acid oxidation and biological process this GO :0030336 and negative regulation of cell migration and biological process this GO :0030853 and negative regulation of granulocyte differentiation and biological process this GO :0031667 and response to nutrient levels and biological process this GO :0031953 and negative regulation of protein autophosphorylation and biological process this GO :0032270 and positive regulation of cellular protein metabolic process and biological process this GO :0032720 and negative regulation of tumor necrosis factor production and biological process this GO :0032757 and positive regulation of interleukin-8 production and biological process this GO :0032869 and cellular response to insulin stimulus and biological process this GO :0033034 and positive regulation of myeloid cell apoptotic process and biological process this GO :0033211 and adiponectin-activated signaling pathway and biological process this GO :0033691 and sialic acid binding and molecular function this GO :0034115 and negative regulation of heterotypic cell-cell adhesion and biological process this GO :0034383 and low-density lipoprotein particle clearance and biological process this GO :0034612 and response to tumor necrosis factor and biological process this GO :0035690 and cellular response to drug and biological process this GO :0042493 and response to drug and biological process this GO :0042593 and glucose homeostasis and biological process this GO :0042802 and identical protein binding and molecular function this GO :0042803 and protein homodimerization activity and molecular function this GO :0043123 and positive regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043124 and negative regulation of I-kappaB kinase/NF-kappaB signaling and biological process this GO :0043407 and negative regulation of MAP kinase activity and biological process this GO :0045087 and innate immune response and biological process this GO :0045471 and response to ethanol and biological process this GO :0045599 and negative regulation of fat cell differentiation and biological process this GO :0045650 and negative regulation of macrophage differentiation and biological process this GO :0045715 and negative regulation of low-density lipoprotein particle receptor biosynthetic process and biological process this GO :0045721 and negative regulation of gluconeogenesis and biological process this GO :0045776 and negative regulation of blood pressure and biological process this GO :0045777 and positive regulation of blood pressure and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0005102 : receptor binding, this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005179 : hormone activity and also this GO :0005515 : protein binding and also this GO :0033691 : sialic acid binding and also this GO :0042802 : identical protein binding and also this GO :0042803 : protein homodimerization activity, this GO :0005125 : cytokine activity, this GO :0005179 : hormone activity, this GO :0005515 : protein binding, this GO :0033691 : sialic acid binding, this GO :0042802 : identical protein binding, this GO :0042803 : protein homodimerization activity, adiponectin |
| Identity: |
13633 |
| Gene: |
ADIPOQ |
More about : ADIPOQ |
| Long gene name: |
C1Q and collagen domain containing , adiponectin |
| Synonyms gene: |
ACDC |
| Synonyms gene name: |
C1Q and collagen domain containing , adipocyte |
| Synonyms: |
ACRP30 AdipoQ apM1 GBP28 adiponectin |
| Synonyms name: |
adipose most abundant gene transcript 1 adiponectin precursor |
| Locus: |
3q27, 3 |
| Discovery year: |
2004-02-26 |
| GenBank acession: |
D45371 |
| Entrez gene record: |
9370 |
| Pubmed identfication: |
7592907 8631877 |
| RefSeq identity: |
NM_004797 |
| Classification: |
C1q and TNF related Endogenous ligands |
| Havana BLAST/BLAT: |
OTTHUMG00000156521 |