Recombinant Human Pancreatic Polypeptide, PPY (C-6His)

Contact us
Catalog number: CI10
Price: 202 €
Supplier: novo
Product name: Recombinant Human Pancreatic Polypeptide, PPY (C-6His)
Quantity: 10 µg
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Pancreatic Polypeptide is produced by our Mammalian expression system and the target gene encoding Ala30-Arg88 is expressed with a 6His tag at the C-terminus
Molecular Weight: 7, 8 kD
UniProt number: P01298
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRVDHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: PPY (C-6His), Pancreatic Polypeptide
Short name: PPY (C-6His), Recombinant Pancreatic Polypeptide
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: PPY (C-6His), sapiens Pancreatic multipeptide, recombinant H
Alternative technique: rec
Identity: 9327
Gene: PPY | More about : PPY
Long gene name: pancreatic polypeptide
Synonyms: PNP
Synonyms name: pancreatic polypeptide Y prepro-PP (prepropancreatic polypeptide)
Locus: 17q21, 31
Discovery year: 1986-01-01
Entrez gene record: 5539
Pubmed identfication: 3753985
RefSeq identity: NM_002722
Classification: Endogenous ligands
Havana BLAST/BLAT: OTTHUMG00000181800

Related Products :

CI10 Recombinant Human Pancreatic Polypeptide, PPY (C-6His) 10 µg 202 € novo human
MBS247121 Goat Polyclonal to Human PPY / Pancreatic Polypeptide Antibody 50ug 597 € MBS Polyclonals_1 human
MBS420040 Goat anti-Pancreatic Polypeptide / PPY Antibody 100ug 370 € MBS Polyclonals_1 human
PPY11-P Mouse Pancreatic polypeptide (PPY) control/blocking peptide # 1 100 μg 188 € adi mouse
PPY11-A Rabbit Anti-mouse Pancreatic polypeptide (PPY) IgG, aff pure #1 100 μg 521 € adi human
GENTAUR-58bcb6862e354 Ceratotherium simum Pancreatic hormone (PPY) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bcb6867952a Ceratotherium simum Pancreatic hormone (PPY) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58ba048798546 Chinchilla chinchilla Pancreatic hormone (PPY) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58ba04881b3fc Chinchilla chinchilla Pancreatic hormone (PPY) 1000ug 2078 € MBS Recombinant Proteins human
AE26172RB-48 ELISA test for Rabbit Pancreatic prohormone (PPY) 1x plate of 48 wells 402 € abebio human
AE26171SH-48 ELISA test for Sheep Pancreatic prohormone (PPY) 1x plate of 48 wells 402 € abebio sheep
GENTAUR-58b8618b87cc5 Equus zebra Pancreatic hormone (PPY) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58b8618c074c1 Equus zebra Pancreatic hormone (PPY) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bd1a71efda0 Lithobates catesbeiana Pancreatic hormone (ppy) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58bd1a7236d5a Lithobates catesbeiana Pancreatic hormone (ppy) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58b87db60f72d Meleagris gallopavo Pancreatic hormone (PPY) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58b87db657be9 Meleagris gallopavo Pancreatic hormone (PPY) 1000ug 2078 € MBS Recombinant Proteins human
AE26172RB Rabbit Pancreatic prohormone (PPY) ELISA Kit 96 wells plate 859 € ab-elisa elisas human
AE26172RB-96 Rabbit Pancreatic prohormone (PPY) ELISA Kit 1x plate of 96 wells 671 € abebio human
GENTAUR-58ba3ee27dffa Rana temporaria Pancreatic hormone (ppy) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58ba3ee356670 Rana temporaria Pancreatic hormone (ppy) 1000ug 2078 € MBS Recombinant Proteins human
GENTAUR-58bccb0cdfc7f Rat Pancreatic prohormone (Ppy) 1000ug 1569 € MBS Recombinant Proteins rat
GENTAUR-58bccb0d3d108 Rat Pancreatic prohormone (Ppy) 1000ug 2078 € MBS Recombinant Proteins rat
AE26171SH Sheep Pancreatic prohormone (PPY) ELISA Kit 48 wells plate 500 € ab-elisa elisas sheep
AE26171SH-96 Sheep Pancreatic prohormone (PPY) ELISA Kit 1x plate of 96 wells 671 € abebio sheep
GENTAUR-58ba945cc2e70 Struthio camelus Pancreatic hormone (PPY) 1000ug 1569 € MBS Recombinant Proteins human
GENTAUR-58ba945d548ba Struthio camelus Pancreatic hormone (PPY) 1000ug 2078 € MBS Recombinant Proteins human
C681 Recombinant Human Pancreatic Lipase-Related Protein 1, PLRP1 (C-6His) 500 µg 1613 € novo human
CA52 Recombinant Human Pancreatic Lipase-Related Protein 2, PLRP2 (C-6His) 10 µg 156 € novo human
CA30 Recombinant Human Ribonuclease Pancreatic, RNASE1 (C-6His) 10 µg 202 € novo human