Recombinant Human Cyclin-H, CCNH (N-6His)

Contact us
Catalog number: CH95
Price: 202 €
Supplier: novo
Product name: Recombinant Human Cyclin-H, CCNH (N-6His)
Quantity: 10 µg
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cyclin-H is produced by our E, coli expression system and the target gene encoding Met1-Leu323 is expressed with a 6His tag at the N-terminus
Molecular Weight: 39, 8 kD
UniProt number: P51946
State of the product: Liquid
Shipping conditions: Dry ice/ice packs
Formulation: 100 mM sodium chloride, 2 mM DTT, 2 mM EDTA, 2 um filtered solution of 20 mM Tris, 30%Glycerol, 5, Supplied as a 0, pH8
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMYHNSSQKRHWTFSSEEQLARLRADANRKFRCKAVANGKVLPNDPVFLEPHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEYHPRIIMLTCAFLACKVDEFNVSSPQFVGNLRESPLGQEKALEQILEYELLLIQQLNFHLIVHNPYRPFEGFLIDLKTRYPILENPEILRKTADDFLNRIALTDAYLLYTPSQIALTAILSSASRAGITMESYLSESLMLKENRTCLSQLLDIMKSMRNLVKKYEPPRSEEVAVLKQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CCNH (N-6His), Cyclin-H
Short name: CCNH (N-6His), Recombinant Cyclin-H
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CCNH (N-6His), sapiens Cyclin-H, recombinant H
Alternative technique: rec
Identity: 1594
Gene: CCNH | More about : CCNH
Long gene name: cyclin H
Synonyms: p34 p37 CycH
Synonyms name: CDK-activating kinase complex subunit cyclin-dependent kinase-activating kinase complex subunit MO15-associated protein CAK complex subunit
Locus: 5q14, 3
Discovery year: 1994-12-16
GenBank acession: U12685
Entrez gene record: 902
Pubmed identfication: 9465303
RefSeq identity: NM_001239
Classification: Cyclins
Havana BLAST/BLAT: OTTHUMG00000119077

Related Products :

CH95 Recombinant Human Cyclin-H, CCNH (N-6His) 50 µg 369 € novo human
GENTAUR-58bde6b8c2fd1 Mouse Monoclonal [clone 1B8] (IgG2a,k) to Human CCNH / Cyclin H Antibody 50ug 663 € MBS mono human
GENTAUR-58be4c949d9f8 CCNH (Cyclin H) Antibody 100ug 393 € MBS mono human
RP-1663H Recombinant Human CDK7 & CCNH & MNAT1 Heterotrimer Protein 20μg 659 € adv human
YSGKAMCC200E Cyclin D1, Cyclin D2, NO X w/Cyclin D3, ~36&34kD, Clone: 5D4, Mouse Monoclonal antibody-Human, Mouse; WB/ICC/IHC 0.1mg 1097 € accurate-monoclonals mouse
YSGKAMCC107E Cyclin Dependent Kinase 2 (cdk2), Cyclin Dependent Kinase 5 (cdk5), NO X w/Cyclin Dependent Kinase (cdk)1, ~33kD, Clone: 8A12, Mouse Monoclonal antibody-Human, Mouse; WB 0.1mg 1271 € accurate-monoclonals mouse
GWB-BSP347 CCNH Human Protein bulk Ask price € genways bulk human
LV110560 CCNH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV110561 CCNH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV110562 CCNH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV110563 CCNH Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
LV110565 CCNH Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 322 € ABM lentivectors human
LV110564 CCNH Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58be0b7c06f63 Anti- CCNH Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0b7cb747b Anti- CCNH Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be0e847ad4d Anti- CCNH Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be0e84d5b16 Anti- CCNH Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be4644a5238 Anti- CCNH Antibody 100ug 393 € MBS Polyclonals human
abx149017 Anti-CCNH Antibody 200 μg 369 € abbex human
abx900883 Anti-CCNH siRNA 15 nmol 528 € abbex human
abx910838 Anti-CCNH siRNA 30 nmol 717 € abbex human
abx910839 Anti-CCNH siRNA 30 nmol 717 € abbex human
GWB-2F51AD CCNH antibody 1 x 1 vial 411 € genways human
GWB-ML124G CCNH antibody 1 vial 521 € genways human
GWB-MX526D CCNH antibody 1 vial 521 € genways human
BIN-000902-M01 CCNH Antibody (M01), clone 1B8 0.1mg 495 € Zyagen human
YSRTMCA2986Z CCNH, Mouse Monoclonal antibody-; Clone: 1B8, IF,WB, Azide Free 0.1 mg Ask price € accurate-monoclonals mouse
GWB-7C472D CCNH Over-expression Lysate reagent 1 tube 463 € genways human
CH94 Recombinant Human Cyclin-D2, CCND2 (N-6His) 1 mg 2283 € novo human
C977 Recombinant Human Cyclin-Dependent Kinase 2-Associated Protein 1, CDK2AP1 (C-6His) 10 µg 202 € novo human