Recombinant Human Pro-Neuregulin-1, NRG1‑β1, HRG1‑β1 (Ser177-Glu241)

Contact us
Catalog number: CH86
Price: 869 €
Supplier: DL elisas
Product name: Recombinant Human Pro-Neuregulin-1, NRG1‑β1, HRG1‑β1 (Ser177-Glu241)
Quantity: 96T
Other quantities: 1 mg 2283€ 10 µg 156€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Neuregulin-1 beta is produced by our E, coli expression system and the target gene encoding Ser177-Glu241 is expressed
Molecular Weight: 5 kD, 7
UniProt number: Q02297-6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: HRG1‑&beta, NRG1‑&beta, 1, 1 (Ser177-Glu241), Pro-Neuregulin-1
Short name: HRG1‑&beta, NRG1‑&beta, 1, 1 (Ser177-Glu241), Recombinant Pro-Neuregulin-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: HRG1‑&beta, neuregulin 1‑&beta, sapiens L-proline-Neuregulin-1, 1, 1 (Ser177-Glu241), recombinant H
Alternative technique: rec
Alternative to gene target: ARIA and GGF and GGF2 and HGL and HRG and HRG1 and HRGA and MST131 and MSTP131 and NDF and NRG1-IT2 and SMDF, DNA-templated and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0051048 and negative regulation of secretion and biological process this GO :0051155 and positive regulation of striated muscle cell differentiation and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055007 and cardiac muscle cell differentiation and biological process this GO :0055012 and ventricular cardiac muscle cell differentiation and biological process this GO :0060045 and positive regulation of cardiac muscle cell proliferation and biological process this GO :0060379 and cardiac muscle cell myoblast differentiation and biological process this GO :0060956 and endocardial cell differentiation and biological process this GO :0061098 and positive regulation of protein tyrosine kinase activity and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, ErbB-3 class receptor binding, NRG1 and IDBG-16182 and ENSG00000157168 and 3084, NRG1 and IDBG-628923 and ENSBTAG00000004150 and 281361, Nrg1 and IDBG-146861 and ENSMUSG00000062991 and 211323, nuclei, this GO :0000165 and MAPK cascade and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0003161 and cardiac conduction system development and biological process this GO :0003222 and ventricular trabecula myocardium morphogenesis and biological process this GO :0003712 and transcription cofactor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005176 and ErbB-2 class receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007154 and cell communication and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0007416 and synapse assembly and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0007507 and heart development and biological process this GO :0007517 and muscle organ development and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009790 and embryo development and biological process this GO :0010001 and glial cell differentiation and biological process this GO :0010667 and negative regulation of cardiac muscle cell apoptotic process and biological process this GO :0014032 and neural crest cell development and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0016477 and cell migration and biological process this GO :0021781 and glial cell fate commitment and biological process this GO :0030296 and protein tyrosine kinase activator activity and molecular function this GO :0030297 and transmembrane receptor protein tyrosine kinase activator activity and molecular function this GO :0030307 and positive regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030879 and mammary gland development and biological process this GO :0030971 and receptor tyrosine kinase binding and molecular function this GO :0031594 and neuromuscular junction and cellular component this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0038127 and ERBB signaling pathway and biological process this GO :0042060 and wound healing and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0043125 and ErbB-3 class receptor binding and molecular function this GO :0043496 and regulation of protein homodimerization activity and biological process this GO :0043497 and regulation of protein heterodimerization activity and biological process this GO :0043624 and cellular protein complex disassembly and biological process this GO :0045087 and innate immune response and biological process this GO :0045202 and synapse and cellular component this GO :0045213 and neurotransmitter receptor metabolic process and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0003712 : transcription cofactor activity, this GO :0003712 : transcription cofactor activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005176 : ErbB-2 class receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030296 : protein tyrosine kinase activator activity and also this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity and also this GO :0030971 : receptor tyrosine kinase binding and also this GO :0043125 : ErbB-3 class receptor binding, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005176 : ErbB-2 class receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0030296 : protein tyrosine kinase activator activity, this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity, this GO :0030971 : receptor tyrosine kinase binding, this GO :0043125 : ErbB-3 class receptor binding, neuregulin 1
Identity: 26035
Gene: SLC48A1 | More about : SLC48A1
Long gene name: solute carrier family 48 member 1
Synonyms gene name: member 1 , solute carrier family 48 (heme transporter)
Synonyms: FLJ20489 hHRG-1 HRG1
Locus: 12q13, 11
Discovery year: 2008-10-17
Entrez gene record: 55652
Pubmed identfication: 18418376
RefSeq identity: NM_017842
Classification: Solute carriers
Havana BLAST/BLAT: OTTHUMG00000156983

Related Products :

CH86 Recombinant Human Pro-Neuregulin-1, NRG1‑β1, HRG1‑β1 (Ser177-Glu241) 50 µg 369 € novo human
CH84 Recombinant Human Pro-Neuregulin-1, NRG1‑β1, HRG1‑β1 (Met1-Lys246, N-6His) 500 µg 709 € novo human
CH83 Recombinant Human Pro-Neuregulin-1, NRG1‑β1, HRG1‑β1 (Thr176-Lys246) 1 mg 1115 € novo human
C753 Recombinant Human Pro-Neuregulin-1, NRG1‑β 1, HRG1‑β 1 (Ser2-Lys246) 50 µg 303 € novo human
SP-100816-1 FDC - SP (61 - 85), human (AA: Phe-Pro-Trp-Phe-Arg-Arg-Asn-Phe-Pro-Ile-Pro-Ile-Pro-Glu-Ser-Ala-Pro-Thr-Thr-Pro-Leu-Pro-Ser-Glu-Lys) (MW: 2925.41) 1 mg 260 € adi human
SP-54847-1 Salusin-α (AA: Ser-Gly-Ala-Leu-Pro-Pro-Ala-Pro-Ala-Ala-Pro-Arg-Pro-Ala-Leu-Arg-Ala-Gln-Arg-Ala-Gly-Pro-Ala-Gly-Pro-Gly-Ala-Lys-NH2) (MW: 2603.05) 1 mg 333 € adi human
SP-62542-1 Chorionic Gonadotropin-β(109-145) (human) (AA: Thr-Cys-Asp-Asp-Pro-Arg-Phe-Gln-Asp-Ser-Ser-Ser-Ser-Lys-Ala-Pro-Pro-Pro-Ser-Leu-Pro-Ser-Pro-Ser-Arg-Leu-Pro-Gly-Pro-Ser-Asp-Thr-Pro-Ile-Leu-Pro-Gln) (MW: 1268.31) 1 mg 405 € adi human
SP-75987-1 Osteocalcin (1-49) (human) [Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Gla-Pro-Arg-Arg-Gla-Val-Cys-Gla-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val] 0,1 mg 478 € adi human
SP-100826-1 Prepro-adrenomedullin (153 - 185), human (AA: Ser-Leu-Pro-Glu-Ala-Gly-Pro-Gly-Arg-Thr-Leu-Val-Ser-Ser-Lys-Pro-Gln-Ala-His-Gly-Ala-Pro-Ala-Pro-Pro-Ser-Gly-Ser-Ala-Pro-His-Phe-Leu) (MW: 3219.6) 1 mg 260 € adi human
SP-58780-1 α-Gliadin (57–73) [Gln-Leu-Gln-Pro-Phe-Pro-Gln-Pro-Glu-Leu-Pro-Tyr-Pro-Gln-Pro-Gln-Ser (MW: 1994.25)] 1 mg 188 € adi human
SP-89345-5 Bradykinin Potentiator C (AA: Pyr-Gly-Leu-Pro-Pro-Gly-Pro-Pro-Ile-Pro-Pro) (MW: 1052.26) 5 mg 333 € adi human
SP-55378-5 Bradykinin Potentiator C [pGlu-Gly-Leu-Pro-Pro-Gly-Pro-Pro-Ile-Pro-Pro-OH; MW: 1052.26] 5 mg 159 € adi human
MBS620141 Corticoliberin, Pro (Pro-Corticoliberin, Pro-CRF, Pro-CRH, Pro Corticotropin releasing hormone, Pro Corticotropin-releasing factor) Antibody 100ug 774 € MBS Polyclonals_1 human
SP-71114-1 Apelin-36, human (AA: Leu-Val-Gln-Pro-Arg-Gly-Ser-Arg-Asn-Gly-Pro-Gly-Pro-Trp-Gln-Gly-Gly-Arg-Arg-Lys-Phe-Arg-Arg-Gln-Arg-Pro-Arg-Leu-Ser-His-Lys-Gly-Pro-Met-Pro-Phe) (MW: 4195.92) 1 mg 333 € adi human
SP-88140-1 Big Gastrin - 1, human (AA: Pyr-Leu-Gly-Pro-Gln-Gly-Pro-Pro-His-Leu-Val-Ala-Asp-Pro-Ser-Lys-Lys-Gln-Gly-Pro-Trp-Leu-Glu-Glu-Glu-Glu-Glu-Ala-Tyr-Gly-Trp-Met-Asp-Phe-NH2) (MW: 3849.30) 1 mg 260 € adi human
SP-100829-1 Human AGRP (25-51) (AA: Leu-Ala-Pro-Met-Glu-Gly-Ile-Arg-Arg-Pro-Asp-Gln-Ala-Leu-Leu-Pro-Glu-Leu-Pro-Gly-Leu-Gly-Leu-Arg-Ala-Pro-Leu) (MW: 2894.5) 1 mg 260 € adi human
SP-87137-5 Osteocalcin (7-19) (human) (AA: Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg) (MW: 1407.6) 5 mg 333 € adi human
SP-100532-1 Prepro-Atrial Natriuretic Factor (56-92) (human) (AA: Glu-Val-Val-Pro-Pro-Gln-Val-Leu-Ser-Glu-Pro-Asn-Glu-Glu-Ala-Gly-Ala-Ala-Leu-Ser-Pro-Leu-Pro-Glu-Val-Pro-Pro-Trp-Thr-Gly-Glu-Val-Ser-Pro-Ala-Gln-Arg) (MW: 3878.3) 1 mg 405 € adi human
SP-55377-5 Bradykinin Potentiator B [pGlu-Gly-Leu-Pro-Pro-Arg-Pro-Lys-Ile-Pro-Pro-OH; MW: 1182.46] 5 mg 159 € adi human
SP-101818-1 Brain Derived Basic Fibroblast Growth Factor (1-24) (AA: Pro-Ala-Leu-Pro-Glu-Asp-Gly-Gly-Ser-Gly-Ala-Phe-Pro-Pro-Gly-His-Phe-Lys-Asp-Pro-Lys-Arg-Leu-Tyr) (MW: 2553.86) 1 mg 260 € adi human
SP-87186-1 Decorsin, Leech (AA: Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu) (MW: 4383.87) 1 mg 478 € adi leech
SP-87461-1 [Des-Asp10]Decorsin, Leech [Ala-Pro-Arg-Leu-Pro-Gln-Cys-Gln-Gly-Asp-Gln-Glu-Lys-Cys-Leu-Cys-Asn-Lys-Asp-Glu-Cys-Pro-Pro-Gly-Gln-Cys-Arg-Phe-Pro-Arg-Gly-Asp-Ala-Asp-Pro-Tyr-Cys-Glu; MW: 4268.78] 1 mg 478 € adi leech
SP-88462-1 Fibrinogen β-Chain (24-42) (AA: Glu-Glu-Ala-Pro-Ser-Leu-Arg-Pro-Ala-Pro-Pro-Pro-Ile-Ser-Gly-Gly-Gly-Tyr-Arg) (MW: 1951.19) 1 mg 333 € adi human
SP-52142-1 HBV core protein (128-140) [H-Thr-Pro-Pro-Ala-Tyr-Arg-Pro-Pro-Asn-Ala-Pro-Ile-Leu-OH; MW: 1406.64] 0,5 mg 159 € adi human
SP-52590-1 HCV-1 e2 Protein (484 - 499) (AA: Pro-Tyr-Cys-Trp-His-Tyr-Pro-Pro-Lys-Pro-Cys-Gly-Ile-Val-Pro-Ala) (MW: 1828.19) 1 mg 188 € adi human
abx570282 Anti-Human Neuregulin 1 (NRG1) ELISA Kit 96 tests 760 € abbex human
MBS242873 Anti-Human NRG1 / Heregulin / Neuregulin 50ug 597 € MBS Polyclonals_1 human
MBS244831 Anti-Human NRG1 / Heregulin / Neuregulin 50ug 597 € MBS Polyclonals_1 human
MBS244876 Anti-Human NRG1 / Heregulin / Neuregulin 50ug 597 € MBS Polyclonals_1 human
DL-NRG1-Hu Human Neuregulin 1 NRG1 ELISA Kit 96T 869 € DL elisas human