| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Neuregulin-1 beta is produced by our E, coli expression system and the target gene encoding Ser177-Glu241 is expressed |
| Molecular Weight: |
5 kD, 7 |
| UniProt number: |
Q02297-6 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HRG1‑&beta, NRG1‑&beta, 1, 1 (Ser177-Glu241), Pro-Neuregulin-1 |
| Short name: |
HRG1‑&beta, NRG1‑&beta, 1, 1 (Ser177-Glu241), Recombinant Pro-Neuregulin-1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
HRG1‑&beta, neuregulin 1‑&beta, sapiens L-proline-Neuregulin-1, 1, 1 (Ser177-Glu241), recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
ARIA and GGF and GGF2 and HGL and HRG and HRG1 and HRGA and MST131 and MSTP131 and NDF and NRG1-IT2 and SMDF, DNA-templated and biological process this GO :0046579 and positive regulation of Ras protein signal transduction and biological process this GO :0048011 and neurotrophin TRK receptor signaling pathway and biological process this GO :0048015 and phosphatidylinositol-mediated signaling and biological process this GO :0048663 and neuron fate commitment and biological process this GO :0051048 and negative regulation of secretion and biological process this GO :0051155 and positive regulation of striated muscle cell differentiation and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0055007 and cardiac muscle cell differentiation and biological process this GO :0055012 and ventricular cardiac muscle cell differentiation and biological process this GO :0060045 and positive regulation of cardiac muscle cell proliferation and biological process this GO :0060379 and cardiac muscle cell myoblast differentiation and biological process this GO :0060956 and endocardial cell differentiation and biological process this GO :0061098 and positive regulation of protein tyrosine kinase activity and biological process this GO :2001240 and negative regulation of extrinsic apoptotic signaling pathway in absence of ligand and biological process, ErbB-3 class receptor binding, NRG1 and IDBG-16182 and ENSG00000157168 and 3084, NRG1 and IDBG-628923 and ENSBTAG00000004150 and 281361, Nrg1 and IDBG-146861 and ENSMUSG00000062991 and 211323, nuclei, this GO :0000165 and MAPK cascade and biological process this GO :0000902 and cell morphogenesis and biological process this GO :0003161 and cardiac conduction system development and biological process this GO :0003222 and ventricular trabecula myocardium morphogenesis and biological process this GO :0003712 and transcription cofactor activity and molecular function this GO :0005102 and receptor binding and molecular function this GO :0005125 and cytokine activity and molecular function this GO :0005176 and ErbB-2 class receptor binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005887 and integral component of plasma membrane and cellular component this GO :0007154 and cell communication and biological process this GO :0007169 and transmembrane receptor protein tyrosine kinase signaling pathway and biological process this GO :0007171 and activation of transmembrane receptor protein tyrosine kinase activity and biological process this GO :0007173 and epidermal growth factor receptor signaling pathway and biological process this GO :0007399 and nervous system development and biological process this GO :0007416 and synapse assembly and biological process this GO :0007422 and peripheral nervous system development and biological process this GO :0007507 and heart development and biological process this GO :0007517 and muscle organ development and biological process this GO :0007626 and locomotory behavior and biological process this GO :0008083 and growth factor activity and molecular function this GO :0008283 and cell proliferation and biological process this GO :0008543 and fibroblast growth factor receptor signaling pathway and biological process this GO :0009790 and embryo development and biological process this GO :0010001 and glial cell differentiation and biological process this GO :0010667 and negative regulation of cardiac muscle cell apoptotic process and biological process this GO :0014032 and neural crest cell development and biological process this GO :0016020 and membrane and cellular component this GO :0016324 and apical plasma membrane and cellular component this GO :0016477 and cell migration and biological process this GO :0021781 and glial cell fate commitment and biological process this GO :0030296 and protein tyrosine kinase activator activity and molecular function this GO :0030297 and transmembrane receptor protein tyrosine kinase activator activity and molecular function this GO :0030307 and positive regulation of cell growth and biological process this GO :0030424 and axon and cellular component this GO :0030879 and mammary gland development and biological process this GO :0030971 and receptor tyrosine kinase binding and molecular function this GO :0031594 and neuromuscular junction and cellular component this GO :0038095 and Fc-epsilon receptor signaling pathway and biological process this GO :0038127 and ERBB signaling pathway and biological process this GO :0042060 and wound healing and biological process this GO :0042177 and negative regulation of protein catabolic process and biological process this GO :0043125 and ErbB-3 class receptor binding and molecular function this GO :0043496 and regulation of protein homodimerization activity and biological process this GO :0043497 and regulation of protein heterodimerization activity and biological process this GO :0043624 and cellular protein complex disassembly and biological process this GO :0045087 and innate immune response and biological process this GO :0045202 and synapse and cellular component this GO :0045213 and neurotransmitter receptor metabolic process and biological process this GO :0045595 and regulation of cell differentiation and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0045860 and positive regulation of protein kinase activity and biological process this GO :0045892 and negative regulation of transcription, this GO :0003712 : transcription cofactor activity, this GO :0003712 : transcription cofactor activity and also this GO :0005102 : receptor binding and also this GO :0005125 : cytokine activity and also this GO :0005176 : ErbB-2 class receptor binding and also this GO :0005515 : protein binding and also this GO :0008083 : growth factor activity and also this GO :0030296 : protein tyrosine kinase activator activity and also this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity and also this GO :0030971 : receptor tyrosine kinase binding and also this GO :0043125 : ErbB-3 class receptor binding, this GO :0005102 : receptor binding, this GO :0005125 : cytokine activity, this GO :0005176 : ErbB-2 class receptor binding, this GO :0005515 : protein binding, this GO :0008083 : growth factor activity, this GO :0030296 : protein tyrosine kinase activator activity, this GO :0030297 : transmembrane receptor protein tyrosine kinase activator activity, this GO :0030971 : receptor tyrosine kinase binding, this GO :0043125 : ErbB-3 class receptor binding, neuregulin 1 |
| Identity: |
26035 |
| Gene: |
SLC48A1 |
More about : SLC48A1 |
| Long gene name: |
solute carrier family 48 member 1 |
| Synonyms gene name: |
member 1 , solute carrier family 48 (heme transporter) |
| Synonyms: |
FLJ20489 hHRG-1 HRG1 |
| Locus: |
12q13, 11 |
| Discovery year: |
2008-10-17 |
| Entrez gene record: |
55652 |
| Pubmed identfication: |
18418376 |
| RefSeq identity: |
NM_017842 |
| Classification: |
Solute carriers |
| Havana BLAST/BLAT: |
OTTHUMG00000156983 |