| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Cardiotrophin-1 is produced by our E, coli expression system and the target gene encoding Met1-Ala201 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
22, 6 kD |
| UniProt number: |
Q16619 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MNHKVHHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CTF1 (N-6His), Cardiotrophin-1 |
| Short name: |
CTF1 (N-6His), Recombinant Cardiotrophin-1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
cardiotrophin 1 (N-6His), sapiens Cardiotrophin-1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
CT-1 and CT1, CTF1 and IDBG-27219 and ENSG00000150281 and 1489, CTF1 and IDBG-639485 and ENSBTAG00000017697 and 514803, Ctf1 and IDBG-210339 and ENSMUSG00000042340 and 13019, Extracellular, leukemia inhibitory factor receptor binding, this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007267 and cell-cell signaling and biological process this GO :0007399 and nervous system development and biological process this GO :0007517 and muscle organ development and biological process this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0048666 and neuron development and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005146 : leukemia inhibitory factor receptor binding, this GO :0005146 : leukemia inhibitory factor receptor binding, cardiotrophin 1 |
| Identity: |
2499 |
| Gene: |
CTF1 |
More about : CTF1 |
| Long gene name: |
cardiotrophin 1 |
| Synonyms: |
CT-1 CT1 |
| Locus: |
16p11, 2 |
| Discovery year: |
1995-05-01 |
| GenBank acession: |
U43030 |
| Entrez gene record: |
1489 |
| Pubmed identfication: |
8833032 |
| RefSeq identity: |
NM_001330 |
| Classification: |
Interleukin 6 cytokine family |
| Havana BLAST/BLAT: |
OTTHUMG00000132413 |
| Locus Specific Databases: |
LRG_408 |