Recombinant Human Cardiotrophin-1, CTF1 (N-6His)

Contact us
Catalog number: CH05
Price: 557 €
Supplier: abbex
Product name: Recombinant Human Cardiotrophin-1, CTF1 (N-6His)
Quantity: 96 tests
Other quantities: 1 mg 2486€ 10 µg 202€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Cardiotrophin-1 is produced by our E, coli expression system and the target gene encoding Met1-Ala201 is expressed with a 6His tag at the N-terminus
Molecular Weight: 22, 6 kD
UniProt number: Q16619
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQLQGDPFGLPSFSPPRLPVAGLSAPAPSHAGLPVHERLRLDAAALAALPPLLDAVCRRQAELNPRAPRLLRRLEDAARQARALGAAVEALLAALGAANRGPRAEPPAATASAASATGVFPAKVLGLRVCGLYREWLSRTEGDLGQLLPGGSA
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CTF1 (N-6His), Cardiotrophin-1
Short name: CTF1 (N-6His), Recombinant Cardiotrophin-1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: cardiotrophin 1 (N-6His), sapiens Cardiotrophin-1, recombinant H
Alternative technique: rec
Alternative to gene target: CT-1 and CT1, CTF1 and IDBG-27219 and ENSG00000150281 and 1489, CTF1 and IDBG-639485 and ENSBTAG00000017697 and 514803, Ctf1 and IDBG-210339 and ENSMUSG00000042340 and 13019, Extracellular, leukemia inhibitory factor receptor binding, this GO :0005125 and cytokine activity and molecular function this GO :0005146 and leukemia inhibitory factor receptor binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0007267 and cell-cell signaling and biological process this GO :0007399 and nervous system development and biological process this GO :0007517 and muscle organ development and biological process this GO :0008283 and cell proliferation and biological process this GO :0008284 and positive regulation of cell proliferation and biological process this GO :0048666 and neuron development and biological process this GO :0048861 and leukemia inhibitory factor signaling pathway and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005146 : leukemia inhibitory factor receptor binding, this GO :0005146 : leukemia inhibitory factor receptor binding, cardiotrophin 1
Identity: 2499
Gene: CTF1 | More about : CTF1
Long gene name: cardiotrophin 1
Synonyms: CT-1 CT1
Locus: 16p11, 2
Discovery year: 1995-05-01
GenBank acession: U43030
Entrez gene record: 1489
Pubmed identfication: 8833032
RefSeq identity: NM_001330
Classification: Interleukin 6 cytokine family
Havana BLAST/BLAT: OTTHUMG00000132413
Locus Specific Databases: LRG_408

Related Products :

CH05 Recombinant Human Cardiotrophin-1, CTF1 (N-6His) 1 mg 2486 € novo human
LV129533 CTF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
LV129534 CTF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 517 € ABM lentivectors human
LV129535 CTF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV129536 CTF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro) 1.0 µg DNA 517 € ABM lentivectors human
LV129538 CTF1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a) 1.0 µg DNA 517 € ABM lentivectors human
LV129537 CTF1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC) 1.0 µg DNA 517 € ABM lentivectors human
abx901319 Anti-CTF1 siRNA 15 nmol 528 € abbex human
abx913083 Anti-CTF1 siRNA inquire 50 € abbex human
abx913084 Anti-CTF1 siRNA 30 nmol 717 € abbex human
GENTAUR-58bdea2cb01cc Anti- CTF1-Specific Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdea2d19808 Anti- CTF1-Specific Antibody 0.06 ml 265 € MBS Polyclonals human
GWB-MS395H CTF1 antibody 1 vial 521 € genways human
GWB-MS396I CTF1 antibody 1 vial 521 € genways human
GWB-BIG054 Recombinant Human Cardiotrophin-1 bulk Ask price € genways bulk human
abx262319 Anti-Cardiotrophin-1 Protein (Recombinant) 10 µg 340 € abbex human
abx262320 Anti-Cardiotrophin-1 Protein (Recombinant) 10 µg 340 € abbex human
abx262321 Anti-Cardiotrophin-1 Protein (Recombinant) 2 µg 238 € abbex human
abx260699 Anti-Cardiotrophin-Like Cytokine Factor 1 Protein (Recombinant) 1 mg 3559 € abbex human
ZR-40-290 Cardiotrophin-1 Recombinant Protein 0.002 mg 256 € Zyagen human
ZR-40-441 Cardiotrophin-1 Recombinant Protein 0.002 mg 256 € Zyagen human
GWB-BIG169 Recombinant Murine Cardiotrophin-1 bulk Ask price € genways bulk human
101-M242 Anti-Human Cardiotrophin-1 100ug 336 € Reliatech antibodies human
GWB-BIG3D5 Anti-Human Cardiotrophin-1 bulk Ask price € genways bulk human
abx574408 Anti-Human Cardiotrophin 1 (CT1) ELISA Kit inquire 50 € abbex human
abx150939 Anti-Human Cardiotrophin 1 ELISA Kit inquire 50 € abbex human
abx250296 Anti-Human Cardiotrophin-1 ELISA Kit inquire 50 € abbex human
BB-EK0563 anti-Human Cardiotrophin-1 ELISA Kit Antibody 96 Tests 790 € acr human
CEK1028 anti-Human Cardiotrophin-1 ELISA Kit Antibody 96 Tests 703 € acr human
abx251180 Anti-Human Cardiotrophin-like cytokine factor 1 ELISA Kit 96 tests 557 € abbex human