Recombinant Human β-2-Microglobulin, B2M (N-6His)

Contact us
Catalog number: CH02
Price: 597 €
Supplier: MBS mono
Product name: Recombinant Human β-2-Microglobulin, B2M (N-6His)
Quantity: 50ug
Other quantities: 1 mg 608€ 10 µg 80€ 50 µg 131€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human beta-2-Microglobulin is produced by our E, coli expression system and the target gene encoding Ile21-Met119 is expressed with a 6His tag at the N-terminus
Molecular Weight: 14 kD
UniProt number: P61769
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: B2M (N-6His), &beta, -2-Microglobulin
Short name: B2M (N-6His), -2-Microglobulin, Recombinant &beta
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: beta-2-microglobulin (N-6His), sapiens &beta, -2-Microglobulin, recombinant H
Alternative technique: rec
Alternative to gene target: B2M and IDBG-646936 and ENSBTAG00000012330 and 280729, B2M and IDBG-9902 and ENSG00000166710 and 567, B2m and IDBG-202736 and ENSMUSG00000060802 and 12010, Extracellular, TAP-dependent and biological process this GO :0002480 and antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent and biological process this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005615 and extracellular space and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005788 and endoplasmic reticulum lumen and cellular component this GO :0005794 and this GO lgi apparatus and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006955 and immune response and biological process this GO :0009897 and external side of plasma membrane and cellular component this GO :0012507 and ER to this GO lgi transport vesicle membrane and cellular component this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0019221 and cytokine-mediated signaling pathway and biological process this GO :0030670 and pha this GO cytic vesicle membrane and cellular component this GO :0031901 and early endosome membrane and cellular component this GO :0031905 and early endosome lumen and cellular component this GO :0033077 and T cell differentiation in thymus and biological process this GO :0042026 and protein refolding and biological process this GO :0042493 and response to drug and biological process this GO :0042590 and antigen processing and presentation of exogenous peptide antigen via MHC class I and biological process this GO :0042612 and MHC class I protein complex and cellular component this GO :0042802 and identical protein binding and molecular function this GO :0045087 and innate immune response and biological process this GO :0046686 and response to cadmium ion and biological process this GO :0050690 and regulation of defense response to virus by virus and biological process this GO :0050776 and regulation of immune response and biological process this GO :0060333 and interferon-gamma-mediated signaling pathway and biological process this GO :0070062 and extracellular vesicular exosome and cellular component, TAP-independent and biological process this GO :0002481 and antigen processing and presentation of exogenous protein antigen via MHC class Ib, identical protein binding, this GO :0000139 and this GO lgi membrane and cellular component this GO :0001895 and retina homeostasis and biological process this GO :0001916 and positive regulation of T cell mediated cytotoxicity and biological process this GO :0002237 and response to molecule of bacterial origin and biological process this GO :0002474 and antigen processing and presentation of peptide antigen via MHC class I and biological process this GO :0002479 and antigen processing and presentation of exogenous peptide antigen via MHC class I, this GO :0005515 : protein binding, this GO :0005515 : protein binding and also this GO :0042802 : identical protein binding, this GO :0042802 : identical protein binding, 783680, beta-2-microglobulin
Identity: 914
Gene: B2M | More about : B2M
Long gene name: beta-2-microglobulin
Locus: 15q21, 1
Discovery year: 2001-06-22
GenBank acession: AB021288
Entrez gene record: 567
RefSeq identity: NM_004048
Classification: C1-set domain containing
Havana BLAST/BLAT: OTTHUMG00000131247

Related Products :

MBS619472 b2-Microglobulin (B2M, Beta 2 Microglobulin precursor, Beta Chain of MHC Class 1 Proteins, HDCMA22P) Antibody 1 mililiter 707 € MBS Polyclonals_1 human
MBS619761 b2-Microglobulin (B2M, Beta 2 Microglobulin Precursor, Beta Chain of MHC Class 1 Proteins, HDCMA22P) Antibody 0.25 ml 520 € MBS Polyclonals_1 human
GENTAUR-58be315f95a6a b2-Microglobulin (B2M, Beta 2 Microglobulin precursor, Beta Chain of MHC Class 1 Proteins, HDCMA22P) (FITC) 100ug 669 € MBS mono human
GENTAUR-58be315f276ec b2-Microglobulin (B2M, Beta 2 Microglobulin precursor, Beta Chain of MHC Class 1 Proteins, HDCMA22P) (FITC) Antibody 100ug 669 € MBS mono human
GENTAUR-58bde5b0ef953 Mouse Monoclonal [clone B2M-01] (IgG2a) to Human B2M / Beta 2 Microglobulin Antibody 50ug 597 € MBS mono human
GENTAUR-58bde81930f09 Mouse Monoclonal [clone B2M-01] (IgG2a) to Human B2M / Beta 2 Microglobulin Antibody 50ug 597 € MBS mono human
GENTAUR-58bde5b23a319 Mouse Monoclonal [clone B2M-02] (IgG1) to Human B2M / Beta 2 Microglobulin Antibody 50ug 597 € MBS mono human
C512 Recombinant Human β-2-Microglobulin, B2M (C-6His) 500 µg 1613 € novo human
CH02 Recombinant Human β-2-Microglobulin, B2M (N-6His) 10 µg 80 € novo human
MBS607766 b2-Microglobulin (B2M) (Beta-2-microglobulin, CDABP0092, HDCMA22P) Antibody 1000ug 431 € MBS Polyclonals_1 human
MBS608517 b2-Microglobulin (B2M, Beta-2-microglobulin, CDABP0092, HDCMA22P) (HRP) Antibody 100ug 442 € MBS Polyclonals_1 human
GWB-EB86D0 B 2-microglobulin (B2M) Mouse antibody to or anti-Human Monoclonal (B2M-01) antibody 1 vial 602 € genways human
GWB-F4CF50 B 2-microglobulin (B2M) Mouse antibody to or anti-Human Monoclonal (B2M-02) antibody 1 vial 602 € genways human
MBS622048 a1-Microglobulin (Alpha-1-Microglobulin, A1M, Alpha-1-Microglobulin/bikunin Precursor, AMBP, AMBP Protein, Alpha-1 Microglycoprotein, EDC1, Growth Inhibiting Protein 19, HCP, HI30, ITI, ITIL, IATIL, ITILC, Protein HC, UTI) Antibody 1 mililiter 580 € MBS Polyclonals_1 human
RP-0106H Recombinant Human B2M / Beta-2-microglobulin Protein (His Tag) 50μg 346 € adv human
RP-1016RC Recombinant Cynomolgus B2M / Beta-2-microglobulin Protein (His Tag) 20μg 572 € adv human
RP-1038M Recombinant Mouse B2M / Beta-2-microglobulin Protein (His Tag) 20μg 572 € adv mouse
RP-2010R Recombinant Rat B2M / Beta-2-microglobulin Protein (His Tag) 20μg 572 € adv rat
MBS240614 Anti-Human B2M / Beta 2 Microglobulin Antibody 50ug 597 € MBS Polyclonals_1 human
abx573204 Anti-Human Beta-2-Microglobulin (b2M) ELISA Kit inquire 50 € abbex human
RS-80B2 Beta 2-Microglobulin (B2M) Reference Standard Host: Human Whole Serum 1.0 mL 128 € icl human
YM1031A Beta-2-Microglobulin, Clone: B2M-01, Mouse Monoclonal antibody-Human 1000ul 626 € accurate-monoclonals human
B2M13-A Goat Anti-Human beta-2 microglobulin (B2M) 100 μg 565 € adi human
MBS243025 Goat Polyclonal (IgG) to Human B2M / Beta 2 Microglobulin Antibody 0.25 miligrams 597 € MBS Polyclonals_1 human
AP50011HU Human Beta-2-Microglobulin (b2M) 0.1mg 498 € AbELISA Rec human
DL-b2M-Hu Human Beta-2-Microglobulin b2M ELISA Kit 96T 672 € DL elisas human
B2M12-M Monoclonal Anti-Human beta-2 microglobulin (B2M) ascites 100 μL 565 € adi human
CSB-DA003CmN①=CSB-MA057861A0m Mouse anti-human Beta-2-microglobulin protein/B2M monoclonal antibody 1mg 271 € IVD Lambert mouse
GENTAUR-58bde5da953bf Mouse Monoclonal [clone 2213] (IgG1) to Human B2M / Beta 2 Microglobulin Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde5d5e7830 Mouse Monoclonal [clone 2M2] (IgG1) to Human B2M / Beta 2 Microglobulin Antibody 50ug 597 € MBS mono human