Recombinant Human Microtubule-associated Proteins 1A, 1B Light Chain 3B, MAP1LC3B

Contact us
Catalog number: CG98
Price: 238 €
Supplier: abbex
Product name: Recombinant Human Microtubule-associated Proteins 1A, 1B Light Chain 3B, MAP1LC3B
Quantity: 5 µg
Other quantities: 1 mg 1877€ 50 µg 303€ 500 µg 1328€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Microtubule-associated Proteins 1A/1B Light Chain 3B is produced by our E, coli expression system and the target gene encoding Met1-Val125 is expressed
Molecular Weight: 14, 8 kD
UniProt number: Q9GZQ8
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 mM DTT, pH8, 2 um filtered solution of 20 mM Tris, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSMPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: 1B Light Chain 3B, MAP1LC3B, Microtubule-associated Proteins 1A
Short name: 1B Light Chain 3B, MAP1LC3B, Recombinant Microtubule-associated Proteins 1A
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: 1B Light epitope 3B, MAP1LC3B, sapiens Microtubule-associated Proteins 1A, recombinant H
Alternative technique: rec
Identity: 13352
Gene: MAP1LC3B | More about : MAP1LC3B
Long gene name: microtubule associated protein 1 light chain 3 beta
Synonyms: ATG8F
Locus: 16q24, 2
Discovery year: 2002-09-16
GenBank acession: AF087871
Entrez gene record: 81631
Classification: Autophagy related
Havana BLAST/BLAT: OTTHUMG00000137654

Related Products :

CG98 Recombinant Human Microtubule-associated Proteins 1A, 1B Light Chain 3B, MAP1LC3B 500 µg 1328 € novo human
GENTAUR-58bd917d98fdd Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd917df0a56 Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58bd917e745f3 Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58bd917edd54c Human Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1923 € MBS Recombinant Proteins human
GENTAUR-58b9a7cdd2118 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58b9a7ce4fac2 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58b9a7ceafa2e Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1934 € MBS Recombinant Proteins bovine
GENTAUR-58b9a7cf26cc7 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1934 € MBS Recombinant Proteins bovine
GENTAUR-58ba22a9a9163 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58ba22aa57d66 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1431 € MBS Recombinant Proteins bovine
GENTAUR-58ba22aaf32b1 Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 100ug 1934 € MBS Recombinant Proteins bovine
GENTAUR-58ba22aba0f5e Bovine Microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B) 1000ug 1934 € MBS Recombinant Proteins bovine
GENTAUR-58bd7ebe68b49 Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b) 100ug 1415 € MBS Recombinant Proteins mouse
GENTAUR-58bd7ebed66ef Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b) 1000ug 1415 € MBS Recombinant Proteins mouse
GENTAUR-58bd7ebf48f77 Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b) 100ug 1923 € MBS Recombinant Proteins mouse
GENTAUR-58bd7ebfa6297 Mouse Microtubule-associated proteins 1A/1B light chain 3B (Map1lc3b) 1000ug 1923 € MBS Recombinant Proteins mouse
MBS613995 MAP1LC3B (LC3B, Autophagy Related Protein LC3B, Autophagy Related Ubiquitin-like Modifier LC3B, MAP1 Light Chain 3-like Protein 2, Microtubule Associated Proteins 1A/1B Light Chain 3B, MAP1A/1B Light Chain 3B, MAP1A/MAP1B LC3B, Microtubule Associated Prot Antibody 100ul 636 € MBS Polyclonals_1 human
abx251588 Anti-Human Microtubule-associated proteins 1A/1B light chain 3A ELISA Kit inquire 50 € abbex human
abx251589 Anti-Human Microtubule-associated proteins 1A/1B light chain 3B ELISA Kit inquire 50 € abbex human
GENTAUR-58ba5a40b3c18 Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 100ug 1415 € MBS Recombinant Proteins human
GENTAUR-58ba5a43241ec Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 1000ug 1415 € MBS Recombinant Proteins human
GENTAUR-58ba5a43a51d7 Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 100ug 1923 € MBS Recombinant Proteins human
GENTAUR-58ba5a4475536 Human Microtubule-associated proteins 1A/1B light chain 3 beta 2 (MAP1LC3B2) 1000ug 1923 € MBS Recombinant Proteins human
abx255115 Anti-Mouse Microtubule-associated proteins 1A/1B light chain 3B ELISA Kit 96 tests 659 € abbex mouse
MBS616757 MAP1LC3C (Microtubule Associated Proteins 1A/1B Light Chain 3C, Autophagy Related Protein LC3C, Autophagy Related Ubiquitin-like Modifier LC3C, LC3C, LC3-like Protein 2, MAP1 Light Chain 3-like Protein 2, MAP1 Light Chain 3-like Protein 3, MAP1A/MAP1BLC3C Antibody 100ul 652 € MBS Polyclonals_1 human
MBS611747 MAP1LC3A, NT (Microtubule Associated Protein 1 Light Chain 3 alpha, MAP1 Light Chain 3A, APG8, Autophagy Related Protein LC3A, Autophagy Related Ubiquitin-like Modifier LC3A, LC3A, MAP1 Light Chain 3 Like Protein 1, Microtubule Associated Proteins 1A/1B L Antibody 100ul 652 € MBS Polyclonals_1 human
MBS620920 TPX2 (Targeting Protein for XKLP2, TPX2 Microtubule-associated Homolog, TPX2 Microtubule-associated Protein Homolog, C20orf2, Chromosome 20 Open Reading Frame 1, C20ORF1, Differentially Expressed in Cancerous and Noncancerous Lung Cells 2, Differentially 100ul 608 € MBS Polyclonals_1 human
CE88 Recombinant Human Microtubule-Associated Protein 1 Light Chain 3 α, MAP1LC3A (C-6His) 500 µg 1613 € novo human
abx261988 Anti-Microtubule-Associated Protein 1 Light Chain 3 alpha Protein (Recombinant) 5 µg 238 € abbex human