Recombinant Human Interleukin-17D, IL-17D

Contact us
Catalog number: CG96
Price: 1703 €
Supplier: Natrols and viral diagnostic antigens
Product name: Recombinant Human Interleukin-17D, IL-17D
Quantity: 1 mg
Other quantities: 1 mg 2283€ 500 µg 1471€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interleukin-17D is produced by our E, coli expression system and the target gene encoding Ala18-Pro202 is expressed
Molecular Weight: 20, 3 kD
UniProt number: Q8TAD2
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 4 mM HCl, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GSAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: IL-17D, Interleukin-17D
Short name: IL-17D, Recombinant Interleukin-17D
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: Interleukin-17D, sapiens Interleukin-17D, recombinant H
Alternative technique: rec
Identity: 5984
Gene: IL17D | More about : IL17D
Long gene name: interleukin 17D
Synonyms: IL-22 IL-27 IL-17D IL27 FLJ30846
Synonyms name: interleukin 27
Locus: 13q12, 11
Discovery year: 2000-05-02
GenBank acession: AY078238
Entrez gene record: 53342
Pubmed identfication: 12097364
RefSeq identity: NM_138284
Classification: Interleukins
Havana BLAST/BLAT: OTTHUMG00000016521

Related Products :

CG96 Recombinant Human Interleukin-17D, IL-17D 10 µg 156 € novo human
abx574376 Anti-Human Interleukin 17D (IL17D) ELISA Kit inquire 50 € abbex human
AE38447HU-48 ELISA test for Human Interleukin-17D (IL17D) 1x plate of 48 wells 373 € abebio human
AE38447HU Human Interleukin-17D (IL17D) ELISA Kit 96 wells plate 769 € ab-elisa elisas human
AE38447HU-96 Human Interleukin-17D (IL17D) ELISA Kit 1x plate of 96 wells 612 € abebio human
DL-IL17D-Hu Human Interleukin 17D IL17D ELISA Kit 96T 846 € DL elisas human
AP23788BT-N anti-Interleukin-17D / IL17D Antibody 50 Вµg 543 € acr human
AP23788BT-S anti-Interleukin-17D / IL17D Antibody 25 Вµg 384 € acr human
AP23788PU-N anti-Interleukin-17D / IL17D Antibody 0,1 mg 543 € acr human
AP23788PU-S anti-Interleukin-17D / IL17D Antibody 50 Вµg 384 € acr human
PA239 anti-Interleukin-17D / IL17D Antibody 5 Вµg 253 € acr human
PA239X anti-Interleukin-17D / IL17D Antibody 25 Вµg 384 € acr human
AP52187PU-N anti-Interleukin-17D / IL17D (C-term) Antibody 0,4 ml 587 € acr human
EKU05246 Interleukin 17D (IL17D) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
GWB-BIG01B Recombinant Human IL-17D bulk Ask price € genways bulk human
ZR-40-270 IL-17D Recombinant Protein 0.005 mg 256 € Zyagen human
YFVEN16-R-10 Recombinant (E. coli) Yellow Fever Virus Env protein (YFV-Env/17D, 445aa) (>95%, his-tag) 10 μg 405 € adi virus
YFVEN16-C Recombinant (E. coli) Yellow Fever Virus Env protein (YFV-Env/17D) Western blot +ve control 100 μL 333 € adi virus
YFVNS15-R-10 Recombinant (HEK) Yellow Fever Virus NS1 protein (YFV-NS1/17D, 779-1136aa) (>95%, his-tag) 10 μg 405 € adi virus
YFVNS15-C Recombinant Yellow Fever Virus NS1 protein (YFV-NS1/17D, 779-1136aa) control for western blot 100 μL 333 € adi virus
101-M488 Anti-Human IL-17D 100ug 336 € Reliatech antibodies human
GWB-BIG2E1 Anti-Human IL-17D bulk Ask price € genways bulk human
GWB-BIG2E0 Biotinylated Anti-Human IL-17D bulk Ask price € genways bulk human
YFV11-M Monoclonal Anti-Yellow Fever Virus (17D) IgG (neutralizing) 100 μL 565 € adi virus
YFVPR17-S Rabbit Anti-Yellow Fever prM Env protein (YFV-Env/17D, 89-aa prM) antiserum 100 μL 536 € adi human
YFVEN16-S Rabbit Anti-Yellow Fever Virus Env protein (YFV-Env/17D) antiserum 100 μL 536 € adi virus
YFVNS15-S Rabbit Anti-Yellow Fever Virus NS1 protein (YFV-NS1/17D, 779-1136aa) antiserum 100 μL 536 € adi virus
YFVPR17-R-10 Yellow Fever Virus prM protein (YFV-Env/17D, 89-aa prM) (>95%, No-tag), synthetic peptide 10 μg 405 € adi virus
0835095CF Yellow Fever Virus Strain: 17D control Culture Fluid for limit of detection determination and positive control 1 mL 462 € Natrols and viral diagnostic antigens virus
835095 Yellow Fever Virus Strain: 17D Lysate 1 mg 1703 € Natrols and viral diagnostic antigens virus