Recombinant Human Profilin-2, PFN2

Catalog number:	CG75 Buy Now
Price:	717 €
Supplier:	abbex
Product name:	Recombinant Human Profilin-2, PFN2
Quantity:	30 nmol
Other quantities:	1 mg 1674€ 50 µg 156€ 500 µg 1186€
Related search:	human pfn sapiens culture identity

More details Need more?:

Reacts with:	Human
Source:	proteins, Recombinants or rec
Description:	Recombinant Human Profilin-2 is produced by our E, coli expression system and the target gene encoding Met1-Phe140 is expressed
Molecular Weight:	15 kD
UniProt number:	P35080
State of the product:	Freeze-dried
Shipping conditions:	Ambient temperature
Formulation:	2 um filtered solution of 20 mM Tris，150 mM sodium chloride，pH 8, Lyophilized from a 0
Storage recommendations:	-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution:	Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity:	and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid:	MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Levels of endotoxin:	11 IEU/ug, LAL test shows less than than 0
Properties:	Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group:	recombinants
Gene target:	PFN2, Profilin-2
Short name:	PFN2, Recombinant Profilin-2
Technique:	E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species:	Humans, Human
Alternative name:	PFN2, sapiens Profilin-2, recombinant H
Alternative technique:	rec
Identity:	8882
Gene:	PFN2 | More about : PFN2
Long gene name:	profilin 2
Locus:	3q25, 1
Discovery year:	1988-08-15
GenBank acession:	L10678
Entrez gene record:	5217
Pubmed identfication:	8975700 8365484
RefSeq identity:	NM_002628
Havana BLAST/BLAT:	OTTHUMG00000159683

• #human
• #pfn
• #sapiens
• #culture
• #identity