Recombinant Human Adaptin Ear-Binding Coat-Associated Protein 2, NECAP2 (N, C-6His)

Contact us
Catalog number: CG68
Price: 2127 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Adaptin Ear-Binding Coat-Associated Protein 2, NECAP2 (N, C-6His)
Quantity: 1000ug
Other quantities: 10 µg 146€ 50 µg 339€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human NECAP2 is produced by our E, coli expression system and the target gene encoding Met1-Phe263 is expressed with a 6His tag at the N-terminus
Molecular Weight: 31, 5 kD
UniProt number: Q9NVZ3
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Supplied as a 0, pH7
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQFLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C-6His), NECAP2 (N, Adaptin Ear-Binding Coat-Associated Protein 2
Short name: C-6His), NECAP2 (N, Recombinant Adaptin Ear-Binding Coat-Associated Protein 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: C-6His), NECAP endocytosis associated 2 (N, sapiens Adaptin Ear-Binding Coat-Associated Protein 2, recombinant H
Alternative technique: rec
Alternative to gene target: NECAP2 and IDBG-645844 and ENSBTAG00000013282 and 509439, NECAP2 and IDBG-91496 and ENSG00000157191 and 55707, Necap2 and IDBG-201832 and ENSMUSG00000028923 and 66147, Plasma membranes, this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005905 and coated pit and cellular component this GO :0006897 and endocytosis and biological process this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0030125 and clathrin vesicle coat and cellular component, NECAP endocytosis associated 2
Identity: 25528
Gene: NECAP2 | More about : NECAP2
Long gene name: NECAP endocytosis associated 2
Synonyms: FLJ10420
Locus: 1p36, 13
Discovery year: 2005-08-15
GenBank acession: AK021938
Entrez gene record: 55707
Pubmed identfication: 14555962 15494011
RefSeq identity: NM_018090
Havana BLAST/BLAT: OTTHUMG00000002313

Related Products :

CG68 Recombinant Human Adaptin Ear-Binding Coat-Associated Protein 2, NECAP2 (N, C-6His) 10 µg 146 € novo human
AE31327RA-48 ELISA test for Rat Adaptin ear-binding coat-associated protein 2 (NECAP2) 1x plate of 48 wells 373 € abebio rat
AE31327RA Rat Adaptin ear-binding coat-associated protein 2 (NECAP2) ELISA Kit 96 wells plate 769 € ab-elisa elisas rat
AE31327RA-96 Rat Adaptin ear-binding coat-associated protein 2 (NECAP2) ELISA Kit 1x plate of 96 wells 612 € abebio rat
AE31330RA-48 ELISA test for Rat Adaptin ear-binding coat-associated protein 1 (NECAP1) 1x plate of 48 wells 373 € abebio rat
GENTAUR-58bd6d427a840 Pongo abelii Adaptin ear-binding coat-associated protein 1 (NECAP1) 100ug 1807 € MBS Recombinant Proteins human
GENTAUR-58bd6d42c91a0 Pongo abelii Adaptin ear-binding coat-associated protein 1 (NECAP1) 1000ug 1807 € MBS Recombinant Proteins human
GENTAUR-58bd6d431f3b2 Pongo abelii Adaptin ear-binding coat-associated protein 1 (NECAP1) 100ug 2321 € MBS Recombinant Proteins human
GENTAUR-58bd6d4364c71 Pongo abelii Adaptin ear-binding coat-associated protein 1 (NECAP1) 1000ug 2321 € MBS Recombinant Proteins human
AE31330RA Rat Adaptin ear-binding coat-associated protein 1 (NECAP1) ELISA Kit 48 wells plate 480 € ab-elisa elisas rat
AE31330RA-96 Rat Adaptin ear-binding coat-associated protein 1 (NECAP1) ELISA Kit 1x plate of 96 wells 612 € abebio rat
GWB-117751 Golgi-associated Gamma-adaptin Ear Containing ARF-binding protein 2 (GGA2) Rabbit antibody to or anti-Human Polyclonal (aa249-265) antibody 1 x 1 vial 602 € genways human
GWB-2629F5 Golgi Associated Gamma Adaptin Ear Containing ARF Binding protein 3 (GGA3) Rabbit antibody to or anti-Human Polyclonal (aa400-415) antibody 1 x 1 vial 602 € genways human
GWB-P1065L NECAP2, 1-263aa, Recombinant Protein bulk Ask price € genways bulk human
GWB-BSP551 NECAP2 Human Protein bulk Ask price € genways bulk human
LV236352 NECAP2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
AR09913PU-L anti-NECAP2 (1-263, His-tag) Antibody 0,5 mg 1138 € acr human
AR09913PU-N anti-NECAP2 (1-263, His-tag) Antibody 0,1 mg 485 € acr human
abx903520 Anti-NECAP2 siRNA inquire 50 € abbex human
abx925683 Anti-NECAP2 siRNA inquire 50 € abbex human
abx925684 Anti-NECAP2 siRNA inquire 50 € abbex human
GWB-MU680E NECAP2 antibody 1 vial 521 € genways human
abx261077 Anti-alpha & gamma Adaptin Binding Protein (Recombinant) 5 µg 238 € abbex human
MBS622089 BAIAP2 (Brain-specific Angiogenesis Inhibitor 1-associated Protein 2, BAI1-associated Protein 2, BAI-associated Protein 2, BAP2, Fas Ligand-associated Factor 3, FLAF3, Insulin Receptor Substrate Protein of 53kD, Insulin Receptor Substrate p53, IRSP53, Ins Antibody 100ug 763 € MBS Polyclonals_1 human
GWB-835BD4 antibody to or anti- Orphan nuclear receptor EAR-2 antibody 1 vial 602 € genways human
GWB-8AE8C4 antibody to or anti- Orphan nuclear receptor EAR-2 antibody 1 vial 602 € genways human
GWB-B9F321 antibody to or anti- Orphan nuclear receptor EAR-2 antibody 1 vial 602 € genways human
GWB-D37B4B antibody to or anti- Orphan nuclear receptor EAR-2 antibody 1 vial 602 € genways human
GENTAUR-58bd5345ce79e Lepomis macrochirus Inner ear-specific collagen 100ug 2127 € MBS Recombinant Proteins human
GENTAUR-58bd53462b97a Lepomis macrochirus Inner ear-specific collagen 1000ug 2127 € MBS Recombinant Proteins human