| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human NECAP2 is produced by our E, coli expression system and the target gene encoding Met1-Phe263 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
31, 5 kD |
| UniProt number: |
Q9NVZ3 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry Ice/ice packs |
| Formulation: |
2 um filtered solution of 20 mM PB，150 mM sodium chloride, 4, Supplied as a 0, pH7 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMEESGYESVLCVKPDVHVYRIPPRATNRGYRAAEWQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESVTDSSRYFVIRIEDGNGRRAFIGIGFGDRGDAFDFNVALQDHFKWVKQQCEFAKQAQNPDQGPKLDLGFKEGQTIKLNIANMKKKEGAAGNPRVRPASTGGLSLLPPPPGGKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQFLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C-6His), NECAP2 (N, Adaptin Ear-Binding Coat-Associated Protein 2 |
| Short name: |
C-6His), NECAP2 (N, Recombinant Adaptin Ear-Binding Coat-Associated Protein 2 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
C-6His), NECAP endocytosis associated 2 (N, sapiens Adaptin Ear-Binding Coat-Associated Protein 2, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
NECAP2 and IDBG-645844 and ENSBTAG00000013282 and 509439, NECAP2 and IDBG-91496 and ENSG00000157191 and 55707, Necap2 and IDBG-201832 and ENSMUSG00000028923 and 66147, Plasma membranes, this GO :0005622 and intracellular and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0005905 and coated pit and cellular component this GO :0006897 and endocytosis and biological process this GO :0015031 and protein transport and biological process this GO :0016020 and membrane and cellular component this GO :0030125 and clathrin vesicle coat and cellular component, NECAP endocytosis associated 2 |
| Identity: |
25528 |
| Gene: |
NECAP2 |
More about : NECAP2 |
| Long gene name: |
NECAP endocytosis associated 2 |
| Synonyms: |
FLJ10420 |
| Locus: |
1p36, 13 |
| Discovery year: |
2005-08-15 |
| GenBank acession: |
AK021938 |
| Entrez gene record: |
55707 |
| Pubmed identfication: |
14555962 15494011 |
| RefSeq identity: |
NM_018090 |
| Havana BLAST/BLAT: |
OTTHUMG00000002313 |