| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
6His tag at the C-terminus, Recombinant Human alpha-Taxilin is produced by our E, coli expression system and the target gene encoding Met1-Lys162 is expressed with a 6His tag at the N-terminus |
| Molecular Weight: |
20, 4 kD |
| UniProt number: |
P40222 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
C-6His), TXLNA (N, &alpha, -Taxilin |
| Short name: |
C-6His), TXLNA (N, -Taxilin, Recombinant &alpha |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans |
| Alternative name: |
C-6His), sapiens &alpha, taxilin alpha (N, -Taxilin, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Extracellular, TXLNA and IDBG-638419 and ENSBTAG00000012867 and 100852159, TXLNA and IDBG-95594 and ENSG00000084652 and 200081, Txlna and IDBG-191432 and ENSMUSG00000053841 and 109658, high molecular weight B cell growth factor receptor binding, this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006887 and exocytosis and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0019905 and syntaxin binding and molecular function this GO :0030372 and high molecular weight B cell growth factor receptor binding and molecular function this GO :0042113 and B cell activation and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0019905 : syntaxin binding and also this GO :0030372 : high molecular weight B cell growth factor receptor binding, this GO :0005515 : protein binding, this GO :0019905 : syntaxin binding, this GO :0030372 : high molecular weight B cell growth factor receptor binding, 511331, taxilin alpha |
| Identity: |
30685 |
| Gene: |
TXLNA |
More about : TXLNA |
| Long gene name: |
taxilin alpha |
| Synonyms: |
DKFZp451J0118 |
| Locus: |
1p35, 2 |
| Discovery year: |
2005-07-29 |
| GenBank acession: |
AF516206 |
| Entrez gene record: |
200081 |
| Pubmed identfication: |
15184072 14623251 |
| RefSeq identity: |
NM_175852 |
| Havana BLAST/BLAT: |
OTTHUMG00000004423 |