Recombinant Human α-Taxilin, TXLNA (N, C-6His)

Contact us
Catalog number: CG41
Price: 332 €
Supplier: Bioss Primary Conjugated Antibodies.
Product name: Recombinant Human α-Taxilin, TXLNA (N, C-6His)
Quantity: 100ul
Other quantities: 10 µg 202€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: 6His tag at the C-terminus, Recombinant Human alpha-Taxilin is produced by our E, coli expression system and the target gene encoding Met1-Lys162 is expressed with a 6His tag at the N-terminus
Molecular Weight: 20, 4 kD
UniProt number: P40222
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MGSSHHHHHHSSGLVPRGSHMKNQDKKNGAAKQSNPKSSPGQPEAGPEGAQERPSQAAPAVEAEGPGSSQAPRKPEGAQARTAQSGALRDVSEELSRQLEDILSTYCVDNNQGGPGEDGAQGEPAEPEDAEKSRTYVARNGEPEPTPVVNGEKEPSKGDPNTEEIRQSDEVGDRDHRRPQEKLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: C-6His), TXLNA (N, &alpha, -Taxilin
Short name: C-6His), TXLNA (N, -Taxilin, Recombinant &alpha
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans
Alternative name: C-6His), sapiens &alpha, taxilin alpha (N, -Taxilin, recombinant H
Alternative technique: rec
Alternative to gene target: Extracellular, TXLNA and IDBG-638419 and ENSBTAG00000012867 and 100852159, TXLNA and IDBG-95594 and ENSG00000084652 and 200081, Txlna and IDBG-191432 and ENSMUSG00000053841 and 109658, high molecular weight B cell growth factor receptor binding, this GO :0005125 and cytokine activity and molecular function this GO :0005515 and protein binding and molecular function this GO :0005576 and extracellular region and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0006887 and exocytosis and biological process this GO :0008283 and cell proliferation and biological process this GO :0016020 and membrane and cellular component this GO :0019905 and syntaxin binding and molecular function this GO :0030372 and high molecular weight B cell growth factor receptor binding and molecular function this GO :0042113 and B cell activation and biological process, this GO :0005125 : cytokine activity, this GO :0005125 : cytokine activity and also this GO :0005515 : protein binding and also this GO :0019905 : syntaxin binding and also this GO :0030372 : high molecular weight B cell growth factor receptor binding, this GO :0005515 : protein binding, this GO :0019905 : syntaxin binding, this GO :0030372 : high molecular weight B cell growth factor receptor binding, 511331, taxilin alpha
Identity: 30685
Gene: TXLNA | More about : TXLNA
Long gene name: taxilin alpha
Synonyms: DKFZp451J0118
Locus: 1p35, 2
Discovery year: 2005-07-29
GenBank acession: AF516206
Entrez gene record: 200081
Pubmed identfication: 15184072 14623251
RefSeq identity: NM_175852
Havana BLAST/BLAT: OTTHUMG00000004423

Related Products :

CG41 Recombinant Human α-Taxilin, TXLNA (N, C-6His) 1 mg 2486 € novo human
abx574971 Anti-Human Taxilin Alpha (TXLNa) ELISA Kit inquire 50 € abbex human
DL-TXLNa-Hu Human Taxilin Alpha TXLNa ELISA Kit 96T 869 € DL elisas human
E-EL-Ch0038 Chicken TXLNa (Taxilin Alpha ) ELISA Kit 96T 568 € elabsciences chicken
MBS621900 Taxilin, alpha (TXLNA, DKFZp451J0118, IL14, MGC118870, MGC118871, RP4-622L5.4, TXLN) Antibody 100ug 774 € MBS Polyclonals_1 human
EKU07578 Taxilin Alpha (TXLNa) ELISA kit 1 plate of 96 wells 783 € Biomatik ELISA kits human
abx166674 Anti-Taxilin alpha Protein (Recombinant) 50 μg 601 € abbex human
abx168348 Anti-Taxilin alpha Protein (Recombinant) 100 μg 847 € abbex human
abx251787 Anti-Human alpha taxilin ELISA Kit inquire 50 € abbex human
abx153234 Anti-Human Taxilin alpha ELISA Kit inquire 50 € abbex human
abx255151 Anti-Mouse alpha taxilin ELISA Kit inquire 50 € abbex mouse
abx128767 Anti-Taxilin alpha Antibody 100 μg 499 € abbex human
abx129547 Anti-Taxilin alpha Antibody 10 μg 267 € abbex human
LV349295 TXLNA Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 517 € ABM lentivectors human
GENTAUR-58be042606730 Anti- TXLNA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be042661b5e Anti- TXLNA Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be079e55233 Anti- TXLNA Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be079e9d23a Anti- TXLNA Antibody 0.12 ml 348 € MBS Polyclonals human
XW-8134 anti-TXLNA Antibody 0.05 mg 180 € proscience human
abx938635 Anti-TXLNA siRNA inquire 50 € abbex human
abx938636 Anti-TXLNA siRNA 15 nmol 528 € abbex human
MBS416746 TXLNA Antibody 100ul 304 € MBS Polyclonals_1 human
MBS852890 TXLNA Antibody 100ug 370 € MBS Polyclonals_1 human
MBS859626 TXLNA Antibody 100ug 370 € MBS Polyclonals_1 human
GWB-D84864 TXLNA Over-expression Lysate reagent 1 vial 463 € genways human
GENTAUR-58be59bf2ab4b Anti-Gamma-taxilin (Polyclonal), ALEXA Fluor 594 100 microliters 489 € Bioss Polyclonal Antibodies human
bs-0631R-A350 Gamma-taxilin Antibody, ALEXA FLUOR 350 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0631R-A488 Gamma-taxilin Antibody, ALEXA FLUOR 488 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0631R-A555 Gamma-taxilin Antibody, ALEXA FLUOR 555 100ul 332 € Bioss Primary Conjugated Antibodies. human
bs-0631R-A594 Gamma-taxilin Antibody, ALEXA FLUOR 594 100ul 332 € Bioss Primary Conjugated Antibodies. human