Recombinant Human Ubiquitin-Like Protein ISG15, ISG15 (C-6His)

Contact us
Catalog number: CG40
Price: 591 €
Supplier: MBS Polyclonals_1
Product name: Recombinant Human Ubiquitin-Like Protein ISG15, ISG15 (C-6His)
Quantity: 100ug
Other quantities: 1 mg 1674€ 10 µg 95€ 500 µg 1186€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Interferon-stimulated Gene 15 is produced by our E, coli expression system and the target gene encoding Gly2-Gly157 is expressed with a 6His tag at the C-terminus
Molecular Weight: 18, 2 kD
UniProt number: P05161
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM HEPES, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: GWDLTVKMLAGNEFQVSLSSSMSVSELKAQITQKIGVHAFQQRLAVHPSGVALQDRVPLASQGLGPGSTVLLVVDKCDEPLNILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGKPLEDQLPLGEYGLKPLSTVFMNLRLRGGLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ISG15 (C-6His), Ubiquitin-Like Protein ISG15
Short name: ISG15 (C-6His), Recombinant Ubiquitin-Like Protein ISG15
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ISG15 (C-6His), sapiens Ubiquitin-Like Protein ISG15, recombinant H
Alternative technique: rec
Identity: 4053
Gene: ISG15 | More about : ISG15
Long gene name: ISG15 ubiquitin-like modifier
Synonyms gene: G1P2
Synonyms gene name: alpha-inducible protein (clone IFI-15K) , interferon
Synonyms: IFI15 UCRP
Locus: 1p36, 33
Discovery year: 1990-10-16
GenBank acession: BC009507
Entrez gene record: 9636
Pubmed identfication: 3087979
RefSeq identity: NM_005101
Havana BLAST/BLAT: OTTHUMG00000040777

Related Products :

CG40 Recombinant Human Ubiquitin-Like Protein ISG15, ISG15 (C-6His) 50 µg 156 € novo human
MBS623932 ISG15, CT (Interferon-induced 17kD Protein, Ubiquitin Cross-reactive Protein, hUCRP, Interferon-induced 15kD Protein,G1P2, UCRP, Ubiquitin-like Protein ISG15, IP17) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623159 USP18 (Ubiquitin Specific Protease 18, Ubiquitin-specific Protease 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Carboxyl-terminal Hydrolase 18, Ubl Thioesterase 18) 100ug 829 € MBS Polyclonals_1 human
GENTAUR-58bceec48212c Bovine Ubiquitin-like protein ISG15 (ISG15) 100ug 1503 € MBS Recombinant Proteins bovine
GENTAUR-58bceec4d5fd3 Bovine Ubiquitin-like protein ISG15 (ISG15) 1000ug 1503 € MBS Recombinant Proteins bovine
GENTAUR-58bceec536d58 Bovine Ubiquitin-like protein ISG15 (ISG15) 100ug 2006 € MBS Recombinant Proteins bovine
GENTAUR-58bceec570137 Bovine Ubiquitin-like protein ISG15 (ISG15) 1000ug 2006 € MBS Recombinant Proteins bovine
MBS623878 SUMO, Pan (Small Ubiquitin-related Modifier 1, SUMO-1, Ubiquitin-like Protein SMT3C, SMT3 Homolog 3, Ubiquitin-homology Domain Protein PIC1, Ubiquitin-like Protein UBL1, GAP Modifying Protein 1, GMP1, Sentrin, SMT3C, SMT3H3, UBL1, Small Ubiquitin-related Antibody 200ul 597 € MBS Polyclonals_1 human
CG31 Recombinant Human Ubiquitin, ISG15-Conjugating Enzyme E2 L6, UBE2L6, , UbcH8 (C-6His) 10 µg 146 € novo human
MBS615874 Interferon Stimulating Gene 15 (ISG15, 15kD ubiquitin-like modifier GIP2, IFI15, Ubiquitin Cross-reactive Protein, UCRP) Antibody 500ug 752 € MBS Polyclonals_1 human
MBS623907 Ubiquitin-like Protein Modifier (Ubiquitin Like Protein Modifier, Homologous to Ubiquitin, Hub1, Hub1 Protein, HUB1 Target Protein 1, Hub1p) Antibody 500ug 829 € MBS Polyclonals_1 human
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
MBS621243 USP11 (Ubiquitin Specific Peptidase 11, Ubiquitin Specific Protease 11, Ubiquitin Specific-processing Protease 11, Deubiquitinating Enzyme 11, Ubiquitin Carboxyl-terminal Hydrolase X-linked, Ubiquitin Thiolesterase 11, UHX1) 100ug 735 € MBS Polyclonals_1 human
abx250970 Anti-Human Ubiquitin-like protein ISG15 ELISA Kit inquire 50 € abbex human
AE37775HU-48 ELISA test for Human Ubiquitin-like modifier (ISG15) 1x plate of 48 wells 402 € abebio human
AE37775HU Human Ubiquitin-like modifier (ISG15) ELISA Kit 48 wells plate 515 € ab-elisa elisas human
AE37775HU-96 Human Ubiquitin-like modifier (ISG15) ELISA Kit 1x plate of 96 wells 671 € abebio human
MBS612461 Interferon Stimulating Gene 15 (ISG15, 15kD Ubiquitin-like Modifier GIP2, G1P2, Interferon Induced 15kD Protein, IFI15, Interferon alpha Inducible Protein, Interferon Stimulated Protein 15kD, Ubiquitin Cross-reactive Protein, UCRP) Antibody 500ug 829 € MBS Polyclonals_1 human
GWB-BFB2E4 Ubiquitin Cross-reactive protein (ISG15) Rabbit antibody to or anti-Human Polyclonal antibody 1 vial 602 € genways human
GENTAUR-58baf51587b91 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 1503 € MBS Recombinant Proteins human
GENTAUR-58baf515c37fd Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 1503 € MBS Recombinant Proteins human
GENTAUR-58baf5162b8eb Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 2006 € MBS Recombinant Proteins human
GENTAUR-58baf51675293 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 2006 € MBS Recombinant Proteins human
GENTAUR-58bb20cf46316 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 1503 € MBS Recombinant Proteins human
GENTAUR-58bb20cf80620 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 1503 € MBS Recombinant Proteins human
GENTAUR-58bb20cfd85a3 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 2006 € MBS Recombinant Proteins human
GENTAUR-58bb20d02c236 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 2006 € MBS Recombinant Proteins human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human