Recombinant Human Ubiquitin, ISG15-Conjugating Enzyme E2 L6, UBE2L6, , UbcH8 (C-6His)

Contact us
Catalog number: CG31
Price: 151 €
Supplier: novo
Product name: Recombinant Human Ubiquitin, ISG15-Conjugating Enzyme E2 L6, UBE2L6, , UbcH8 (C-6His)
Quantity: 50 µg
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 18, 8 kD
UniProt number: O14933
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 50 mM HEPES, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKAFNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVDRPSLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ISG15-Conjugating E2 L6, UBE2L6, UbcH8 (C-6His), Ubiquitin
Short name: ISG15-Conjugating Enzyme E2 L6, UBE2L6, UbcH8 (C-6His), Recombinant Ubiquitin
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: , ISG15-Conjugating Enzyme E2 L6, UBE2L6, UbcH8 (C-6His), sapiens Ubiquitin, recombinant H
Alternative technique: rec
Identity: 12490
Gene: UBE2L6 | More about : UBE2L6
Long gene name: ubiquitin conjugating enzyme E2 L6
Synonyms gene name: ubiquitin-conjugating enzyme E2L 6
Synonyms: UBCH8
Locus: 11q12, 1
Discovery year: 1999-02-26
GenBank acession: AF031141 AK093462 BC032491
Entrez gene record: 9246
Pubmed identfication: 9153201
RefSeq identity: NM_004223
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000167047

Related Products :

CG31 Recombinant Human Ubiquitin, ISG15-Conjugating Enzyme E2 L6, UBE2L6, , UbcH8 (C-6His) 10 µg 146 € novo human
MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
GENTAUR-58baf51587b91 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 1503 € MBS Recombinant Proteins human
GENTAUR-58baf515c37fd Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 1503 € MBS Recombinant Proteins human
GENTAUR-58baf5162b8eb Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 2006 € MBS Recombinant Proteins human
GENTAUR-58baf51675293 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 2006 € MBS Recombinant Proteins human
GENTAUR-58bb20cf46316 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 1503 € MBS Recombinant Proteins human
GENTAUR-58bb20cf80620 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 1503 € MBS Recombinant Proteins human
GENTAUR-58bb20cfd85a3 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 100ug 2006 € MBS Recombinant Proteins human
GENTAUR-58bb20d02c236 Human Ubiquitin/ISG15-conjugating enzyme E2 L6 (UBE2L6) 1000ug 2006 € MBS Recombinant Proteins human
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
RP-1589H Recombinant Human UBCH8 / UBE2L6 Protein (His Tag) 20μg 572 € adv human
CG40 Recombinant Human Ubiquitin-Like Protein ISG15, ISG15 (C-6His) 50 µg 156 € novo human
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human
MBS623932 ISG15, CT (Interferon-induced 17kD Protein, Ubiquitin Cross-reactive Protein, hUCRP, Interferon-induced 15kD Protein,G1P2, UCRP, Ubiquitin-like Protein ISG15, IP17) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS623159 USP18 (Ubiquitin Specific Protease 18, Ubiquitin-specific Protease 18, 43kD ISG15-specific Protease, ISG43, hUBP43, ISG15-specific-processing Protease, Ubl Carboxyl-terminal Hydrolase 18, Ubl Thioesterase 18) 100ug 829 € MBS Polyclonals_1 human
MBS617434 Ubiquitin Conjugating Enzyme E2L3 (UBE2L3, ubiquitin-conjugating enzyme E2L 3, UBCH7) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS619190 Ubc9 (Ubiquitin Carrier Protein 9, Ubiquitin Conjugating Enzyme 9, UBC 9, UBC9 Homolog, UBC-9, UBCE9, C358B7.1, Homologous to Yeast UBC9, p18, SUMO Conjugating Enzyme UBC9, SUMO Protein Ligase, SUMO-1 Conjugating Enzyme, SUMO-1-protein Ligase, SUMO1 Conju 100ug 735 € MBS Polyclonals_1 yeast
GENTAUR-58bceec48212c Bovine Ubiquitin-like protein ISG15 (ISG15) 100ug 1503 € MBS Recombinant Proteins bovine
GENTAUR-58bceec4d5fd3 Bovine Ubiquitin-like protein ISG15 (ISG15) 1000ug 1503 € MBS Recombinant Proteins bovine
GENTAUR-58bceec536d58 Bovine Ubiquitin-like protein ISG15 (ISG15) 100ug 2006 € MBS Recombinant Proteins bovine
GENTAUR-58bceec570137 Bovine Ubiquitin-like protein ISG15 (ISG15) 1000ug 2006 € MBS Recombinant Proteins bovine
MBS612110 RAD6 (Rad-6, BHR6A, hHR6A, HR6A, mHR6A, RAD6A, RAD6B, UBC-1, UBC2, UBC6, UBCD6, UBE2B, Ubiquitin Carrier Protein, Ubiquitin-conjugating Enzyme E2 A, UBE2A, Ubiquitin-conjugating Enzyme E2-17kD, Ubiquitin-conjugating enzyme E2-21.5kD, Ubiquitin-protein Lig Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human
MBS624307 UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) Antibody 100ug 658 € MBS Polyclonals_1 human
C183 Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His) 10 µg 80 € novo human
C862 Recombinant Human Ubiquitin-Conjugating Enzyme E2 B, UBE2B, HR6B (C-6His) 50 µg 369 € novo human
CG01 Recombinant Human Ubiquitin-Conjugating Enzyme E2 C, UBE2C, UBCH10 (N-6His) 50 µg 339 € novo human
CG45 Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-6His, SUMO tag) 10 µg 80 € novo human
CG23 Recombinant Human Ubiquitin-Conjugating Enzyme E2 R2, UBE2R2, UBC3B (N-6His) 50 µg 151 € novo human