Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme, GST

Contact us
Catalog number: CG20
Price: 2116 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme, GST
Quantity: 100ug
Other quantities: 1 mg 456€ 10 µg 80€ 50 µg 110€
Related search:

More details :

Reacts with: Schistosoma Japonicum
Source: proteins, Recombinants or rec
Description: 1 kDa = 1000 g/mol protein, GST compared to your protein ladder can be shifted a little due to electrophoresis effects, The kilo Daltons subunit weight of Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 Isozyme
Molecular Weight: 25, 7 kD
UniProt number: P08515
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: pH7, 2 um filtered solution of phosphate buffered saline, 4, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSD
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Group: recombinants
Gene target: GST, Schistosoma Japonicum Glutathione S-transferase Class-mu 26 Isozyme
Short name: GST, Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 Isozyme
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Alternative name: GST, recombinant Schistosoma Japonicum GSH S-transferase Class-mu 26 kiloDalton Isozyme
Alternative technique: rec

Related Products :

CG20 Recombinant Schistosoma Japonicum Glutathione S-transferase Class-mu 26 kDa Isozyme, GST 500 µg 354 € novo human
GENTAUR-58b9b1d6225d5 Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 100ug 1658 € MBS Recombinant Proteins human
GENTAUR-58b9b1d69da56 Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 1658 € MBS Recombinant Proteins human
GENTAUR-58b9b1d6f2844 Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 100ug 2172 € MBS Recombinant Proteins human
GENTAUR-58b9b1d76803a Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 2172 € MBS Recombinant Proteins human
GENTAUR-58ba2fa244caa Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 100ug 1658 € MBS Recombinant Proteins human
GENTAUR-58ba2fa2defea Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 1658 € MBS Recombinant Proteins human
GENTAUR-58ba2fa38c331 Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 100ug 2172 € MBS Recombinant Proteins human
GENTAUR-58ba2fa422644 Schistosoma japonicum Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 2172 € MBS Recombinant Proteins human
GENTAUR-58b37e016d9ed Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 100ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b37e01a6bad Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 1000ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b37e01d0fd3 Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 100ug 2144 € MBS Recombinant Proteins human
GENTAUR-58b37e021c0a2 Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 1000ug 2144 € MBS Recombinant Proteins human
GENTAUR-58b4356967ff2 Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 100ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b43569966cd Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 1000ug 1630 € MBS Recombinant Proteins human
GENTAUR-58b43569d882c Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 100ug 2144 € MBS Recombinant Proteins human
GENTAUR-58b4356a21832 Schistosoma japonicum Glutathione S-transferase class-mu 28 kDa isozyme 1000ug 2144 € MBS Recombinant Proteins human
RP-288A Recombinant Schistosoma japonicum Glutathione S-transferase / GST Protein 50μg 346 € adv human
GST17-R Purified Recombinant Glutathione Transferase (GST, S. japonicum) protein, native S. Japonicum (No tag) 100 μg 405 € adi human
GENTAUR-58b9dd19a4a96 Schistosoma bovis Glutathione S-transferase class-mu 28 kDa isozyme 100ug 1641 € MBS Recombinant Proteins human
GENTAUR-58b9dd19ee6f7 Schistosoma bovis Glutathione S-transferase class-mu 28 kDa isozyme 1000ug 1641 € MBS Recombinant Proteins human
GENTAUR-58b9dd1a45cc3 Schistosoma bovis Glutathione S-transferase class-mu 28 kDa isozyme 100ug 2155 € MBS Recombinant Proteins human
GENTAUR-58b9dd1a99a27 Schistosoma bovis Glutathione S-transferase class-mu 28 kDa isozyme 1000ug 2155 € MBS Recombinant Proteins human
GENTAUR-58b8bf11ce85a Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 100ug 1603 € MBS Recombinant Proteins human
GENTAUR-58b8bf123574e Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 1603 € MBS Recombinant Proteins human
GENTAUR-58b8bf129b765 Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 100ug 2116 € MBS Recombinant Proteins human
GENTAUR-58b8bf12eb3de Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 2116 € MBS Recombinant Proteins human
GENTAUR-58b9bf6b68bd4 Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 100ug 1603 € MBS Recombinant Proteins human
GENTAUR-58b9bf6bdf989 Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 1000ug 1603 € MBS Recombinant Proteins human
GENTAUR-58b9bf6c5665d Schistosoma mansoni Glutathione S-transferase class-mu 26 kDa isozyme 100ug 2116 € MBS Recombinant Proteins human