| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human NCR3 is produced by our Mammalian expression system and the target gene encoding Leu19-Thr138 is expressed with a Fc tag at the C-terminus |
| Molecular Weight: |
2 kD, 40 |
| UniProt number: |
O14931 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD337 (C-Fc), NKp30, NCR3 |
| Short name: |
CD337 (C-Fc), NKp30, Recombinant NCR3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD337 (C-fragment c), NKp30, sapiens natural cytotoxicity triggering receptor 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
NCR3 and IDBG-634145 and ENSBTAG00000018343 and 513769, NCR3 and IDBG-78112 and ENSG00000204475 and 259197, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008037 and cell recognition and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, natural cytotoxicity triggering receptor 3 |
| Identity: |
19077 |
| Gene: |
NCR3 |
More about : NCR3 |
| Long gene name: |
natural cytotoxicity triggering receptor 3 |
| Synonyms gene: |
LY117 |
| Synonyms gene name: |
lymphocyte antigen 117 |
| Synonyms: |
1C7 NKp30 CD337 |
| Locus: |
6p21, 33 |
| Discovery year: |
2002-08-05 |
| GenBank acession: |
AB055881 |
| Entrez gene record: |
259197 |
| Pubmed identfication: |
8824804 11782277 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031123 |