Recombinant Human NCR3, NKp30, CD337 (C-Fc)

Contact us
Catalog number: CG15
Price: 387 €
Supplier: MBS Polyclonals
Product name: Recombinant Human NCR3, NKp30, CD337 (C-Fc)
Quantity: 100ug
Other quantities: 1 mg 2486€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human NCR3 is produced by our Mammalian expression system and the target gene encoding Leu19-Thr138 is expressed with a Fc tag at the C-terminus
Molecular Weight: 2 kD, 40
UniProt number: O14931
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 2 um filtered solution of 20 mM PB,150 mM sodium chloride, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: CD337 (C-Fc), NKp30, NCR3
Short name: CD337 (C-Fc), NKp30, Recombinant NCR3
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: CD337 (C-fragment c), NKp30, sapiens natural cytotoxicity triggering receptor 3, recombinant H
Alternative technique: rec
Alternative to gene target: NCR3 and IDBG-634145 and ENSBTAG00000018343 and 513769, NCR3 and IDBG-78112 and ENSG00000204475 and 259197, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008037 and cell recognition and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, natural cytotoxicity triggering receptor 3
Identity: 19077
Gene: NCR3 | More about : NCR3
Long gene name: natural cytotoxicity triggering receptor 3
Synonyms gene: LY117
Synonyms gene name: lymphocyte antigen 117
Synonyms: 1C7 NKp30 CD337
Locus: 6p21, 33
Discovery year: 2002-08-05
GenBank acession: AB055881
Entrez gene record: 259197
Pubmed identfication: 8824804 11782277
Classification: CD molecules V-set domain containing
Havana BLAST/BLAT: OTTHUMG00000031123

Related Products :

C379 Recombinant Human NCR3, NKp30, CD337 (C-6His) 500 µg 1613 € novo human
CG15 Recombinant Human NCR3, NKp30, CD337 (C-Fc) 1 mg 2486 € novo human
CC40 Recombinant Human NCR3, NKp30, CD337 (Leu19-Gly135,C-Fc) 50 µg 369 € novo human
abx257677 Anti-Human NKp30/NCR3 ELISA Kit inquire 50 € abbex human
GWB-308A10 NKp30 (NCR3) (clone y4E6), Antibody bulk Ask price € genways bulk human
101-M586 Anti-Human NKp30 100ug 336 € Reliatech antibodies human
GWB-BSP931 NKp30 Antibody bulk Ask price € genways bulk human
AR51403PU-N anti-CD337 (19-138, His-tag) Antibody 0,5 mg 1109 € acr human
AR51403PU-S anti-CD337 (19-138, His-tag) Antibody 0,1 mg 485 € acr human
AM31295AF-N anti-CD337 Antibody 0,2 mg 442 € acr human
AM31295FC-N anti-CD337 Antibody 1ml (100T) 442 € acr human
AM31295PU-N anti-CD337 Antibody 2ml (200T) 413 € acr human
AP21200PU-N anti-CD337 Antibody 0,1 mg 558 € acr human
C16875-1 anti-CD337 Antibody 50 Вµg 347 € acr human
C16875-2 anti-CD337 Antibody 0,1 mg 500 € acr human
RP-1106H Recombinant Human NCR3 / NKp300 Protein (His & Fc Tag) 20μg 572 € adv human
RP-1105H Recombinant Human NCR3 / NKp300 Protein (His Tag) 20μg 572 € adv human
GENTAUR-58bc55aa93d60 Human Natural cytotoxicity triggering receptor 3 (NCR3) 100ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bc55ab5cdaa Human Natural cytotoxicity triggering receptor 3 (NCR3) 1000ug 1409 € MBS Recombinant Proteins human
GENTAUR-58bc55ab9190d Human Natural cytotoxicity triggering receptor 3 (NCR3) 100ug 1912 € MBS Recombinant Proteins human
GENTAUR-58bc55abd4efe Human Natural cytotoxicity triggering receptor 3 (NCR3) 1000ug 1912 € MBS Recombinant Proteins human
GWB-ASE753 Human NCR3 Antibody bulk Ask price € genways bulk human
GWB-ATG0B9 NCR3, 19-138aa Human, His tag, E.coli bulk Ask price € genways bulk human
LV235296 NCR3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
A04N0026 anti-NCR3 Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
GENTAUR-58bdf8e7ccd82 Anti- NCR3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdf8e88cce8 Anti- NCR3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be13e65c286 Anti- NCR3 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58be13e6d2007 Anti- NCR3 Antibody 0.06 ml 265 € MBS Polyclonals human
GENTAUR-58be51dcc6bbb Anti- NCR3 Antibody 100ug 387 € MBS Polyclonals human