| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Natural Cytotoxicity Triggering Receptor 3 is produced by our Mammalian expression system and the target gene encoding Leu19-Thr138 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
12, 84 kD |
| UniProt number: |
O14931 |
| State of the product: |
Liquid |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, pH 7, 2, 2 um filtered solution of 20 mM PB, Lyophilized from a 0 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Avoid mixing using vortex or pipettes, Dissolve the protein in ddH2O, In order to retain the quality and the affinity of the product unchanged, It is not recommended to dilute the product to less than 100 &mu, avoid cycles of freezing and thawing, please, The vials should be centrifuged before it is opened, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTVDHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
CD337 (C-6His), NKp30, NCR3 |
| Short name: |
CD337 (C-6His), NKp30, Recombinant NCR3 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
CD337 (C-6His), NKp30, sapiens natural cytotoxicity triggering receptor 3, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
NCR3 and IDBG-634145 and ENSBTAG00000018343 and 513769, NCR3 and IDBG-78112 and ENSG00000204475 and 259197, Plasma membranes, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005887 and integral component of plasma membrane and cellular component this GO :0006954 and inflammatory response and biological process this GO :0006955 and immune response and biological process this GO :0008037 and cell recognition and biological process this GO :0045954 and positive regulation of natural killer cell mediated cytotoxicity and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, natural cytotoxicity triggering receptor 3 |
| Identity: |
19077 |
| Gene: |
NCR3 |
More about : NCR3 |
| Long gene name: |
natural cytotoxicity triggering receptor 3 |
| Synonyms gene: |
LY117 |
| Synonyms gene name: |
lymphocyte antigen 117 |
| Synonyms: |
1C7 NKp30 CD337 |
| Locus: |
6p21, 33 |
| Discovery year: |
2002-08-05 |
| GenBank acession: |
AB055881 |
| Entrez gene record: |
259197 |
| Pubmed identfication: |
8824804 11782277 |
| Classification: |
CD molecules V-set domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031123 |