Recombinant Human Sulfotransferase 2A1, SULT2A1 (N-6His)

Contact us
Catalog number: CF92
Price: 464 €
Supplier: MBS mono
Product name: Recombinant Human Sulfotransferase 2A1, SULT2A1 (N-6His)
Quantity: 100ug
Other quantities: 1 mg 2283€ 10 µg 146€ 500 µg 1613€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Sulfotransferase 2A1 is produced by our E, coli expression system and the target gene encoding Ser2-Glu285 is expressed with a 6His tag at the N-terminus
Molecular Weight: 2 kD, 35
UniProt number: Q06520
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 100 mM sodium chloride, pH 8, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSKGDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLMRNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFLLLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVVDKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: SULT2A1 (N-6His), Sulfotransferase 2A1
Short name: SULT2A1 (N-6His), Recombinant Sulfotransferase 2A1
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: SULT2A1 (N-6His), sapiens Sulfotransferase 2A1, recombinant H
Alternative technique: rec
Identity: 11458
Gene: SULT2A1 | More about : SULT2A1
Long gene name: sulfotransferase family 2A member 1
Synonyms gene: STD
Synonyms gene name: 2A, cytosolic, dehydroepiandrosterone (DHEA)-preferring, member 1 , sulfotransferase family
Synonyms: DHEA-ST
Locus: 19q13, 33
Discovery year: 1994-03-03
GenBank acession: X70222
Entrez gene record: 6822
Pubmed identfication: 1588921 7736787
RefSeq identity: NM_003167
Classification: Sulfotransferases, cytosolic
Havana BLAST/BLAT: OTTHUMG00000162469

Related Products :

CF92 Recombinant Human Sulfotransferase 2A1, SULT2A1 (N-6His) 500 µg 1613 € novo human
MBS624314 SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1, Alcohol Sulfotransferase, HSST2, Hydroxysteroid Sulfotransferase 2, ST2B1, Sulfotransferase 2B1) Antibody 100ug 774 € MBS Polyclonals_1 human
MBS622667 SULT4A1 (sulfotransferase family 4A, Member 1, Brain sulfotransferase-like protein, Nervous system sulfotransferase, brain sulphotransferase-like, nervous system cytosolic sulfotransferase, sulfotransferase-related protein) Antibody 100ug 774 € MBS Polyclonals_1 human
GENTAUR-58b8190bc9c93 Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b8190c33a6e Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 1000ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b8190c9e9cb Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b8190cf190d Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 1000ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b8428f2e462 Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 100ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b8428f77535 Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 1000ug 1835 € MBS Recombinant Proteins human
GENTAUR-58b8428fadafd Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 100ug 2343 € MBS Recombinant Proteins human
GENTAUR-58b842902a0fe Macaca fascicularis Bile salt sulfotransferase (SULT2A1) 1000ug 2343 € MBS Recombinant Proteins human
MBS620110 Carbohydrate Sulfotransferase 1 (CHST1, Carbohydrate (keratan sulfate Gal-6) sulfotransferase 1, C6ST, Carbohydrate Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 1, GST-1, Keratan sulfate Gal-6 sulfotransferase, KS6ST, KSGal6ST, K 100ug 774 € MBS Polyclonals_1 human
MBS620338 Carbohydrate Sulfotransferase 2 (CHST2, Carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, C6ST, Carbohydrate Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 2, GlcNAc6ST-1, Gn6ST, GN6ST, GST2, GST-2, N-acetylglucosamine 6-O 100ug 774 € MBS Polyclonals_1 human
MBS621259 Carbohydrate Sulfotransferase 4 (CHST4, Carbohydrate (CHST4, Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GlcNAc6ST-2, GST-3, HEC-GlcNAc6ST, HEC-GLCNAC-6-ST, L-selecti Antibody 100ug 774 € MBS Polyclonals_1 human
MBS621397 Carbohydrate Sulfotransferase 5 (CHST5, Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 5, ALYE870, FLJ22167, GlcNAc6ST-3, GST4-alpha, hIGn6ST, I-GlcNAc6ST, Intestinal GlcNAc-6-sulfotransferase, MGC74625, PRO1886) 100ug 509 € MBS Polyclonals_1 human
MBS621707 Carbohydrate Sulfotransferase (CHST4, Carbohydrate (N-acetylglucosamine 6-O) sulfotransferase 4, Galactose/N-acetylglucosamine/N-acetylglucosamine 6-O-sulfotransferase 3, GlcNAc6ST-2, GST-3, HEC-GlcNAc6ST, HEC-GLCNAC-6-ST, L-selectin ligand sulfotransfera Antibody 100ug 553 € MBS Polyclonals_1 human
MBS624612 SULT1C1, ID (Sulfotransferase 1C2, ST1C2, Sulfotransferase 1C1, SULT1C#1, humSULTC2, SULT1C2) Antibody 200ul 603 € MBS Polyclonals_1 human
CF97 Recombinant Human Sulfotransferase 1A1, SULT1A1 (N-6His) 1 mg 2486 € novo human
CE94 Recombinant Human Sulfotransferase 1A2, SULT1A2 (N-6His) 1 mg 2283 € novo human
CG03 Recombinant Human Sulfotransferase 1A3, SULT1A3 (N-6His) 1 mg 2486 € novo human
CF90 Recombinant Human Sulfotransferase 1B1, SULT1B1 (N-6His) 500 µg 1755 € novo human
CF91 Recombinant Human Sulfotransferase 1C2, SULT1C2 (N-6His) 500 µg 1613 € novo human
CE93 Recombinant Human Sulfotransferase 2B1, SULT2B1 (C-6His) 50 µg 303 € novo human
RP-1475H Recombinant Human SULT2A1 / STD Protein (His Tag) 20μg 624 € adv human
GWB-P0955F SULT2A1, 1-285aa, Recombinant Protein bulk Ask price € genways bulk human
GENTAUR-58bde7164814f Mouse Monoclonal [clone 2A1] (IgG1,l) to Human MAP4K1 / HPK1 Antibody 0.05 ml 597 € MBS mono human
GENTAUR-58bde5ee2d528 Mouse Monoclonal [clone 2A1] (IgG,k) to Human TGM2 / Transglutaminase 2 Antibody 0.05 ml 597 € MBS mono human
SIMA2A1 Small Intestinal Mucinous Antigen (SIMA), Clone: SIMA 2A1, Mouse Monoclonal antibody-Human; frozen/paraffin, IH 1000ul 948 € accurate-monoclonals human
GENTAUR-58be2e026df63 Transferrin receptor 1, Human, mAb 3B8 2A1 100ug 464 € MBS mono human
GENTAUR-58be2e0207a4b Transferrin receptor 1, Human, mAb 3B8 2A1 Antibody 100ug 464 € MBS mono human