Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His)

Contact us
Catalog number: CF89
Price: 1613 €
Supplier: novo
Product name: Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His)
Quantity: 500 µg
Other quantities: 1 mg 2486€ 50 µg 496€ 500 µg 1755€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Actin-Related Protein 8/ACTR8 is produced by our E, coli expression system and the target gene encoding Met1-Trp329 is expressed with a 6His tag at the N-terminus
Molecular Weight: 1 kD, 38
UniProt number: Q9H981-3
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 1 mM DTT, 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MNHKVHHHHHHMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRIFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPMALFYPATFGIVGQKMTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDGLMAGNDSEEALTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGGGLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGAVLACLDTTQELWIYQREWQRFGVRMLRERAAFVW
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: ACTR8 (N-6His), Actin-Related Protein 8
Short name: ACTR8 (N-6His), Recombinant Actin- Protein 8
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: ACTR8 (N-6His), sapiens Actin-Related Protein 8, recombinant H
Alternative technique: rec
Identity: 14672
Gene: ACTR8 | More about : ACTR8
Long gene name: ARP8 actin-related protein 8 homolog
Synonyms gene name: ARP8 (actin-related protein 8, yeast) homolog
Synonyms: INO80N
Synonyms name: INO80 complex subunit N
Locus: 3p21, 1
Discovery year: 2001-06-11
Entrez gene record: 93973
Pubmed identfication: 18163988 16230350
RefSeq identity: NM_022899
Classification: INO80 complex
Havana BLAST/BLAT: OTTHUMG00000158279

Related Products :

CF89 Recombinant Human Actin-Related Protein 8, ACTR8 (N-6His) 1 mg 2486 € novo human
GENTAUR-58bdb78169020 Mouse Actin-related protein 8 (Actr8) 100ug 2702 € MBS Recombinant Proteins mouse
GENTAUR-58bdb781c8086 Mouse Actin-related protein 8 (Actr8) 1000ug 2702 € MBS Recombinant Proteins mouse
GENTAUR-58bdb7824288b Mouse Actin-related protein 8 (Actr8) 100ug 3172 € MBS Recombinant Proteins mouse
GENTAUR-58bdb7829ae95 Mouse Actin-related protein 8 (Actr8) 1000ug 3172 € MBS Recombinant Proteins mouse
MBS624618 ACTR3B, CT (Actin-related Protein 3B, Actin-like Protein 3B, ARP3-beta, Actin-related Protein ARP4, ARP4, ARP11) Antibody 200ul 603 € MBS Polyclonals_1 human
MBS621802 SMARCC1 (SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin C1, SWI/SNF-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily C Member 1, SMARC-C1, AI115498, BRG1-associated Factor 155, BAF155, Chromatin Remodeli Antibody 100ul 785 € MBS Polyclonals_1 human
LV791025 ACTR8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
LV791026 ACTR8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA) 1.0 µg DNA 322 € ABM lentivectors human
LV791027 ACTR8 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro) 1.0 µg DNA 322 € ABM lentivectors human
GENTAUR-58bdfdf106b12 Anti- ACTR8 Antibody 0.12 ml 348 € MBS Polyclonals human
GENTAUR-58bdfdf15dd22 Anti- ACTR8 Antibody 0.06 ml 265 € MBS Polyclonals human
abx906664 Anti-ACTR8 siRNA inquire 50 € abbex human
abx906665 Anti-ACTR8 siRNA 30 nmol 717 € abbex human
MBS621291 Bcl 2-Related Protein A1 (Bcl 2 Related Protein A1, Bcl-2-related Protein A1, ACC-1, ACC-2, BCL2L5, BFL1, BFL-1, GRS, Hematopoietic Bcl2-related Protein A1, HBPA1, Hemopoietic-specific Early Response Protein, Protein BFL-1, Protein GRS) Antibody 50ug 724 € MBS Polyclonals_1 human
MBS621773 Actin-like 7B (ACTL7B, MGC151192, MGC151194, Tact1, actin-like 7-beta, t-actin 1) Antibody 100ug 591 € MBS Polyclonals_1 human
MBS624518 ACTR3, CT (Actin-related Protein 3, Actin-like Protein 3, ARP3) Antibody 200ul 603 € MBS Polyclonals_1 human
CE15 Recombinant Human β-Actin, ACTB (C-6His) 500 µg 1613 € novo human
C103 Recombinant Human Bcl-2 Related Protein A1, BCL2A1 (C-6His) 1 mg 2283 € novo human
C823 Recombinant Human Carbonic Anhydrase-Related Protein 11, CA11 (C-6His) 10 µg 202 € novo human
C517 Recombinant Human Complement Factor H-Related Protein 2, CFHR2 (C-6His) 50 µg 369 € novo human
CC49 Recombinant Human Dickkopf-Related Protein 2, DKK-2 (N-Fc, C-6His) 50 µg 369 € novo human
C412 Recombinant Human Dickkopf-Related Protein 3, DKK3 (C-6His) 500 µg 1613 € novo human
CC94 Recombinant Human Follistatin-Related Protein 1, FSTL1 (C-6His) 500 µg 1613 € novo human
CF23 Recombinant Human Follistatin-Related Protein 1, FSTL1 (C-6His, E. coli) 50 µg 369 € novo e-coli
CE89 Recombinant Human Galectin-Related Protein, LGALSL (C-6His) 50 µg 339 € novo human
C611 Recombinant Human Glioma Pathogenesis-Related Protein 1, GLIPR1, RTVP1 (C-6His) 10 µg 202 € novo human
C389 Recombinant Human Low-Density Lipoprotein Receptor Related Protein 12, LRP12 (C-6His) 500 µg 1613 € novo human
CI04 Recombinant Human Mammalian Ependymin-Related Protein 1, EPDR1, UCC1 (C-6His) 1 mg 1115 € novo human
C681 Recombinant Human Pancreatic Lipase-Related Protein 1, PLRP1 (C-6His) 500 µg 1613 € novo human