| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Hyaluronic Acid-binding Protein is produced by our E, coli expression system and the target gene encoding Leu74-Gln282 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
24, 9 kD |
| UniProt number: |
Q07021 |
| State of the product: |
Liquid |
| Shipping conditions: |
Dry ice/ice packs |
| Formulation: |
1 mM DTT, 20% Glycerol, pH 7, 2 um filtered solution of 20 mM Tris, 5, Supplied as a 0 |
| Storage recommendations: |
-20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
HABP1 (C-6His), C1QBP |
| Short name: |
HABP1 (C-6His), Recombinant C1QBP |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
HABP1 (C-6His), q subcomponent binding protein, sapiens complement component 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
C1QBP and IDBG-21497 and ENSG00000108561 and 708, C1QBP and IDBG-634029 and ENSBTAG00000012739 and 518321, C1qbp and IDBG-195770 and ENSMUSG00000018446 and 12261, DNA-templated and biological process this GO :0006397 and mRNA processing and biological process this GO :0006915 and apoptotic process and biological process this GO :0006955 and immune response and biological process this GO :0006958 and complement activation, classical pathway and biological process this GO :0007596 and blood coagulation and biological process this GO :0007597 and blood coagulation, gC1Q-R and GC1QBP and gC1qR and HABP1 and p32 and SF2p32, intrinsic pathway and biological process this GO :0008134 and transcription factor binding and molecular function this GO :0008380 and RNA splicing and biological process this GO :0009986 and cell surface and cellular component this GO :0014065 and phosphatidylinositol 3-kinase signaling and biological process this GO :0016020 and membrane and cellular component this GO :0016032 and viral process and biological process this GO :0030449 and regulation of complement activation and biological process this GO :0030984 and kininogen binding and molecular function this GO :0031690 and adrenergic receptor binding and molecular function this GO :0032689 and negative regulation of interferon-gamma production and biological process this GO :0032695 and negative regulation of interleukin-12 production and biological process this GO :0039534 and negative regulation of MDA-5 signaling pathway and biological process this GO :0039536 and negative regulation of RIG-I signaling pathway and biological process this GO :0042256 and mature ribosome assembly and biological process this GO :0043065 and positive regulation of apoptotic process and biological process this GO :0045087 and innate immune response and biological process this GO :0045785 and positive regulation of cell adhesion and biological process this GO :0048025 and negative regulation of mRNA splicing, mitochondrial ribosome binding, nuclei, q subcomponent binding protein, this GO :0000122 and negative regulation of transcription from RNA polymerase II promoter and biological process this GO :0001849 and complement component C1q binding and molecular function this GO :0003714 and transcription corepressor activity and molecular function this GO :0003729 and mRNA binding and molecular function this GO :0005080 and protein kinase C binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005540 and hyaluronic acid binding and molecular function this GO :0005615 and extracellular space and cellular component this GO :0005634 and nucleus and cellular component this GO :0005730 and nucleolus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005739 and mitochondrion and cellular component this GO :0005759 and mitochondrial matrix and cellular component this GO :0005829 and cytosol and cellular component this GO :0005886 and plasma membrane and cellular component this GO :0006351 and transcription, this GO :0001849 : complement component C1q binding, this GO :0001849 : complement component C1q binding and also this GO :0003714 : transcription corepressor activity and also this GO :0003729 : mRNA binding and also this GO :0005080 : protein kinase C binding and also this GO :0005515 : protein binding and also this GO :0005540 : hyaluronic acid binding and also this GO :0008134 : transcription factor binding and also this GO :0030984 : kininogen binding and also this GO :0031690 : adrenergic receptor binding and also this GO :0097177 : mitochondrial ribosome binding, this GO :0003714 : transcription corepressor activity, this GO :0003729 : mRNA binding, this GO :0005080 : protein kinase C binding, this GO :0005515 : protein binding, this GO :0005540 : hyaluronic acid binding, this GO :0008134 : transcription factor binding, this GO :0030984 : kininogen binding, this GO :0031690 : adrenergic receptor binding, this GO :0097177 : mitochondrial ribosome binding, via spliceosome and biological process this GO :0050687 and negative regulation of defense response to virus and biological process this GO :0051897 and positive regulation of protein kinase B signaling and biological process this GO :0070131 and positive regulation of mitochondrial translation and biological process this GO :0090023 and positive regulation of neutrophil chemotaxis and biological process this GO :0097177 and mitochondrial ribosome binding and molecular function this GO :1900026 and positive regulation of substrate adhesion-dependent cell spreading and biological process this GO :1901165 and positive regulation of trophoblast cell migration and biological process this GO :2000510 and positive regulation of dendritic cell chemotaxis and biological process, complement component 1 |
| Identity: |
1243 |
| Gene: |
C1QBP |
More about : C1QBP |
| Long gene name: |
complement C1q binding protein |
| Synonyms gene: |
HABP1 |
| Synonyms gene name: |
complement component 1, q subcomponent binding protein |
| Synonyms: |
gC1Q-R gC1qR p32 SF2p32 |
| Synonyms name: |
C1q globular domain-binding protein hyaluronan-binding protein 1 splicing factor SF2-associated protein |
| Locus: |
17p13, 2 |
| Discovery year: |
1995-12-11 |
| GenBank acession: |
X75913 |
| Entrez gene record: |
708 |
| Pubmed identfication: |
8567680 8195709 |
| RefSeq identity: |
NM_001212 |
| Havana BLAST/BLAT: |
OTTHUMG00000177875 |