| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Astrocytic Phosphoprotein PEA-15 is produced by our E, coli expression system and the target gene encoding Met1-Ala130 is expressed |
| Molecular Weight: |
15, 3 kD |
| UniProt number: |
Q15121 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
GSHMAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
PEA15, Astrocytic Phosphoprotein PEA-15 |
| Short name: |
PEA15, Recombinant Astrocytic Phosphoprotein PEA-15 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
phosphoprotein enriched in astrocytes 15, sapiens Astrocytic Phosphoprotein PEA-15, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
Cytoplasm, HMAT1 and HUMMAT1H and MAT1 and MAT1H and PEA-15 and PED, PEA15 and IDBG-104008 and ENSG00000162734 and 8682, PEA15 and IDBG-630628 and ENSBTAG00000005793 and 510586, Pea15a and IDBG-205249 and ENSMUSG00000013698 and 18611, protein binding, this GO :0005515 and protein binding and molecular function this GO :0005737 and cytoplasm and cellular component this GO :0005875 and microtubule associated complex and cellular component this GO :0006810 and transport and biological process this GO :0006915 and apoptotic process and biological process this GO :0008643 and carbohydrate transport and biological process this GO :0042981 and regulation of apoptotic process and biological process this GO :0043278 and response to morphine and biological process this GO :0046325 and negative regulation of glucose import and biological process this GO :1902042 and negative regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process this GO :1902043 and positive regulation of extrinsic apoptotic signaling pathway via death domain receptors and biological process, this GO :0005515 : protein binding, this GO :0005515 : protein binding, phosphoprotein enriched in astrocytes 15 |
| Identity: |
8822 |
| Gene: |
PEA15 |
More about : PEA15 |
| Long gene name: |
phosphoprotein enriched in astrocytes 15 |
| Synonyms: |
HMAT1 MAT1 PED PEA-15 MAT1H HUMMAT1H |
| Synonyms name: |
15kD homolog of mouse MAT-1 oncogene , Phosphoprotein enriched in astrocytes |
| Locus: |
1q23, 2 |
| Discovery year: |
1998-11-06 |
| GenBank acession: |
Y13736 |
| Entrez gene record: |
8682 |
| Pubmed identfication: |
9205133 |
| RefSeq identity: |
NM_003768 |
| Classification: |
Death effector domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031605 |