Recombinant Human PDCD4, H731 (C-6His)

Contact us
Catalog number: CF62
Price: 500 €
Supplier: acr
Product name: Recombinant Human PDCD4, H731 (C-6His)
Quantity: 0,1 mg
Other quantities: 1 mg 2283€ 10 µg 156€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Programmed Cell Death Protein 4 is produced by our E, coli expression system and the target gene encoding Lys212-Pro357 is expressed with a 6His tag at the C-terminus
Molecular Weight: 17 kD
UniProt number: Q53EL6
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: H731 (C-6His), PDCD4
Short name: H731 (C-6His), Recombinant PDCD4
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: H731 (C-6His), sapiens programmed cellular death 4 (neoplastic transformation inhibitor), recombinant H
Alternative technique: rec
Alternative to gene target: DNA-templated and biological process, PDCD4 and IDBG-639738 and ENSBTAG00000019434 and 506724, PDCD4 and IDBG-89535 and ENSG00000150593 and 100616113, Pdcd4 and IDBG-176913 and ENSMUSG00000024975 and 18569, nuclei, protein binding, this GO :0003723 and RNA binding and molecular function this GO :0005488 and binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0006915 and apoptotic process and biological process this GO :0007569 and cell aging and biological process this GO :0043508 and negative regulation of JUN kinase activity and biological process this GO :0045786 and negative regulation of cell cycle and biological process this GO :0045892 and negative regulation of transcription, this GO :0003723 : RNA binding, this GO :0003723 : RNA binding and also this GO :0005488 : binding and also this GO :0005515 : protein binding, this GO :0005488 : binding, this GO :0005515 : protein binding, 27250, programmed cell death 4 (neoplastic transformation inhibitor)
Identity: 8763
Gene: PDCD4 | More about : PDCD4
Long gene name: programmed cell death 4
Synonyms gene name: programmed cell death 4 (neoplastic transformation inhibitor)
Synonyms: H731
Synonyms name: nuclear antigen H731
Locus: 10q25, 2
Discovery year: 2000-05-10
GenBank acession: U83908
Entrez gene record: 27250
Pubmed identfication: 9759869
RefSeq identity: NM_014456
Havana BLAST/BLAT: OTTHUMG00000019048

Related Products :

MBS612882 PDCD4, CT (Programmed Cell Death 4, Neoplastic Transformation Inhibitor, H731, MGC33046, MGC33047, Nuclear Antigen H731, OTTHUMP00000020483, Protein 197/15a, RP11 348N5.4) Antibody 100ug 569 € MBS Polyclonals_1 human
MBS618247 PDCD4, phosphorylated (Ser457) (Programmed Cell Death 4, Neoplastic Transformation Inhibitor, H731, MGC33046, MGC33047, Nuclear Antigen H731, OTTHUMP00000020483, Protein 197/15a, RP11 348N5.4) Antibody 100ug 829 € MBS Polyclonals_1 human
CF62 Recombinant Human PDCD4, H731 (C-6His) 1 mg 2283 € novo human
GWB-P0096E PDCD4, 1-469 aa, Recombinant Protein bulk Ask price € genways bulk human
MBS241304 Anti-Human PDCD4 50ug 597 € MBS Polyclonals_1 human
MBS240264 Anti-Human PDCD4 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS240442 Anti-Human PDCD4 Antibody 50ug 597 € MBS Polyclonals_1 human
MBS222849 Anti-HUMAN PDCD4 (C-TERMINAL) 50ug 475 € MBS Polyclonals_1 human
MBS248125 Goat Polyclonal to Human PDCD4 Antibody 50ug 597 € MBS Polyclonals_1 human
GWB-ASB556 Human PDCD4 (Phospho-Ser457) Antibody bulk Ask price € genways bulk human
GWB-ASB555 Human PDCD4 (Phospho-Ser67) Antibody bulk Ask price € genways bulk human
GENTAUR-58bde5fe95316 Mouse Monoclonal [clone K4C1] (IgG1,k) to Human PDCD4 Antibody 50ug 597 € MBS mono human
MBS247771 PAb (IgG) to Human PDCD4 100ul 597 € MBS Polyclonals_1 human
LV815594 Pdcd4 Lentiviral Vector (human) (CMV) (pLenti-GIII-CMV) 1.0 µg DNA 322 € ABM lentivectors human
GWB-28218E Programmed Cell Death 4 (PDCD4) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 x 1 vial 602 € genways human
GWB-942377 Programmed Cell Death 4 (PDCD4) Rabbit antibody to or anti-Human Polyclonal (C- terminus) antibody 1 vial 602 € genways human
GWB-28C544 Programmed Cell Death 4 (PDCD4) Rabbit antibody to or anti-Human Polyclonal (pSer457) antibody 1 x 1 vial 602 € genways human
AR09066PU-L anti-PDCD4 (1-469) Antibody 0,5 mg 1138 € acr human
AR09066PU-N anti-PDCD4 (1-469) Antibody 0,1 mg 485 € acr human
AP32008PU-N anti-PDCD4 (210-221) Antibody 0,1 mg 558 € acr human
A03P0092 anti-PDCD4 (Ab-457) Antibody 200ug (50ug, 100ug available) 465 € Bluegen antibodies human
AM09026PU-N anti-PDCD4 Antibody 0,1 ml 500 € acr human
AM09026PU-S anti-PDCD4 Antibody 50 Вµl 384 € acr human
AP05695PU-N anti-PDCD4 Antibody 50 Вµg 529 € acr human
AP07337PU-N anti-PDCD4 Antibody 50 Вµg 732 € acr human
AP20338PU-N anti-PDCD4 Antibody 0,1 mg 558 € acr human
B1174-1 anti-PDCD4 Antibody 50 Вµg 347 € acr human
B1174-2 anti-PDCD4 Antibody 0,1 mg 500 € acr human
B1175-1 anti-PDCD4 Antibody 50 Вµg 347 € acr human
B1175-2 anti-PDCD4 Antibody 0,1 mg 500 € acr human