Recombinant Human Acyl-Protein Thioesterase 2, LYPLA2, APT2 (C-6His)

Contact us
Catalog number: CF43
Price: 2056 €
Supplier: MBS Recombinant Proteins
Product name: Recombinant Human Acyl-Protein Thioesterase 2, LYPLA2, APT2 (C-6His)
Quantity: 1000ug
Other quantities: 1 mg 2283€ 10 µg 146€ 50 µg 339€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Recombinant Human Lysophospholipase II is produced by our E, coli expression system and the target gene encoding Met1-Val231 is expressed with a 6His tag at the C-terminus
Molecular Weight: 25, 8 kD
UniProt number: O95372
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 0, 1 mM DTT, pH 8, 1M sodium chloride, 2 um filtered solution of 20 mM Tris, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPVLEHHHHHH
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: APT2 (C-6His), LYPLA2, Acyl-Protein Thioesterase 2
Short name: APT2 (C-6His), LYPLA2, Recombinant Acyl-Protein Thioesterase 2
Technique: E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: APT2 (C-6His), LYPLA2, sapiens Acyl-Protein Thioesterase 2, recombinant H
Alternative technique: rec
Identity: 6738
Gene: LYPLA2 | More about : LYPLA2
Long gene name: lysophospholipase II
Synonyms: APT-2
Locus: 1p36, 11
Discovery year: 1999-09-29
GenBank acession: AF098668
Entrez gene record: 11313
Havana BLAST/BLAT: OTTHUMG00000002961

Related Products :

CF43 Recombinant Human Acyl-Protein Thioesterase 2, LYPLA2, APT2 (C-6His) 50 µg 339 € novo human
GENTAUR-58b9e0d64cdbf Human Acyl-protein thioesterase 2 (LYPLA2) 100ug 1691 € MBS Recombinant Proteins human
GENTAUR-58b9e0d6b8c3c Human Acyl-protein thioesterase 2 (LYPLA2) 1000ug 1691 € MBS Recombinant Proteins human
GENTAUR-58b9e0d71e914 Human Acyl-protein thioesterase 2 (LYPLA2) 100ug 2205 € MBS Recombinant Proteins human
GENTAUR-58b9e0d79ad8a Human Acyl-protein thioesterase 2 (LYPLA2) 1000ug 2205 € MBS Recombinant Proteins human
AE34731RA-48 ELISA test for Rat Acyl-protein thioesterase 2 (LYPLA2) 1x plate of 48 wells 373 € abebio rat
GENTAUR-58bd5de30c415 Rat Acyl-protein thioesterase 2 (Lypla2) 100ug 1691 € MBS Recombinant Proteins rat
GENTAUR-58bd5de379862 Rat Acyl-protein thioesterase 2 (Lypla2) 1000ug 1691 € MBS Recombinant Proteins rat
GENTAUR-58bd5de3be2e6 Rat Acyl-protein thioesterase 2 (Lypla2) 100ug 2205 € MBS Recombinant Proteins rat
GENTAUR-58bd5de41b78b Rat Acyl-protein thioesterase 2 (Lypla2) 1000ug 2205 € MBS Recombinant Proteins rat
AE34731RA Rat Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit 96 wells plate 769 € ab-elisa elisas rat
AE34731RA-96 Rat Acyl-protein thioesterase 2 (LYPLA2) ELISA Kit 1x plate of 96 wells 612 € abebio rat
C097 Recombinant Human Acyl-Protein Thioesterase 1, APT-1 (N-6His) 10 µg 156 € novo human
C891 Recombinant Human Acyl-Coenzyme A Thioesterase 13, ACOT13 (C-6His) 500 µg 1613 € novo human
CC64 Recombinant Human Palmitoyl-Protein Thioesterase 1, PPT1 (C-6His) 10 µg 146 € novo human
RP-1031H Recombinant Human LYPLA2 / APT-2 Protein (His Tag) 20μg 572 € adv human
GWB-P1112G LYPLA2, 1-231aa, Recombinant Protein bulk Ask price € genways bulk human
AM20195AF-N anti-ABCB3 / APT2 / TAP2 (434-703) Antibody 0,1 mg 500 € acr human
BB-PA2116 anti-ABCB3 / APT2 / TAP2 Antibody 0,1 mg 471 € acr human
AE62250DU Duck Anti-prothrombins antibodies (aPT1/aPT2) ELISA Kit 96 wells plate 840 € ab-elisa elisas human
AE62250DU-96 Duck Anti-prothrombins antibodies (aPT1/aPT2) ELISA Kit 1x plate of 96 wells 671 € abebio human
AE62250DU-48 ELISA test for Duck Anti-prothrombins antibodies (aPT1/aPT2) 1x plate of 48 wells 402 € abebio human
GENTAUR-58bd25318e468 Methanococcus maripaludis Adenine phosphoribosyltransferase (apt2) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bd2531cfcc1 Methanococcus maripaludis Adenine phosphoribosyltransferase (apt2) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58bd2532302ad Methanococcus maripaludis Adenine phosphoribosyltransferase (apt2) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58bd25328584c Methanococcus maripaludis Adenine phosphoribosyltransferase (apt2) 1000ug 2056 € MBS Recombinant Proteins human
GENTAUR-58ba5a4478195 Methanococcus vannielii Adenine phosphoribosyltransferase (apt2) 100ug 1553 € MBS Recombinant Proteins human
GENTAUR-58ba5a44e4054 Methanococcus vannielii Adenine phosphoribosyltransferase (apt2) 1000ug 1553 € MBS Recombinant Proteins human
GENTAUR-58ba5a453ad0e Methanococcus vannielii Adenine phosphoribosyltransferase (apt2) 100ug 2056 € MBS Recombinant Proteins human
GENTAUR-58ba5a458ecdf Methanococcus vannielii Adenine phosphoribosyltransferase (apt2) 1000ug 2056 € MBS Recombinant Proteins human