| Reacts with: |
Human |
| Source: |
proteins, Recombinants or rec |
| Description: |
Recombinant Human Allograft Inflammatory Factor 1 is produced by our E, coli expression system and the target gene encoding Ser2-Pro147 is expressed with a 6His tag at the C-terminus |
| Molecular Weight: |
17, 7 kD |
| UniProt number: |
P55008 |
| State of the product: |
Freeze-dried |
| Shipping conditions: |
Ambient temperature |
| Formulation: |
150 mM sodium chloride, 2 um filtered solution of 20 mM PB, 4, Lyophilized from a 0, pH7 |
| Storage recommendations: |
-20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at < |
| Reconstitution: |
Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml |
| Purity: |
and determined by Polyacrylamide gel electrophoresis, Greater than 95% |
| Sequence of the amino acid: |
SQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELPLEHHHHHH |
| Levels of endotoxin: |
11 IEU/ug, LAL test shows less than than 0 |
| Properties: |
Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine, , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp |
| Group: |
recombinants |
| Gene target: |
AIF1 (C-6His), Allograft Inflammatory Factor 1 |
| Short name: |
AIF1 (C-6His), Recombinant Allograft Inflammatory Factor 1 |
| Technique: |
E, coli recombinant proteins are , novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli |
| Species: |
Humans, Human |
| Alternative name: |
allograft inflammatory factor 1 (C-6His), sapiens Allograft Inflammatory Factor 1, recombinant H |
| Alternative technique: |
rec |
| Alternative to gene target: |
AIF-1 and IBA1 and IRT-1 and IRT1, AIF1 and IDBG-634144 and ENSBTAG00000020554 and 280989, AIF1 and IDBG-78190 and ENSG00000204472 and 199, Aif1 and IDBG-177226 and ENSMUSG00000024397 and 11629, actin filament binding, engulfment and biological process this GO :0006954 and inflammatory response and biological process this GO :0010629 and negative regulation of gene expression and biological process this GO :0014739 and positive regulation of muscle hyperplasia and biological process this GO :0016601 and Rac protein signal transduction and biological process this GO :0030027 and lamellipodium and cellular component this GO :0030041 and actin filament polymerization and biological process this GO :0030335 and positive regulation of cell migration and biological process this GO :0031668 and cellular response to extracellular stimulus and biological process this GO :0032587 and ruffle membrane and cellular component this GO :0032870 and cellular response to hormone stimulus and biological process this GO :0034097 and response to cytokine and biological process this GO :0042102 and positive regulation of T cell proliferation and biological process this GO :0042995 and cell projection and cellular component this GO :0043066 and negative regulation of apoptotic process and biological process this GO :0043204 and perikaryon and cellular component this GO :0045429 and positive regulation of nitric oxide biosynthetic process and biological process this GO :0048471 and perinuclear region of cytoplasm and cellular component this GO :0048661 and positive regulation of smooth muscle cell proliferation and biological process this GO :0048662 and negative regulation of smooth muscle cell proliferation and biological process this GO :0048678 and response to axon injury and biological process this GO :0051015 and actin filament binding and molecular function this GO :0051017 and actin filament bundle assembly and biological process this GO :0051602 and response to electrical stimulus and biological process this GO :0071315 and cellular response to morphine and biological process this GO :0071346 and cellular response to interferon-gamma and biological process this GO :0071447 and cellular response to hydroperoxide and biological process this GO :0071672 and negative regulation of smooth muscle cell chemotaxis and biological process this GO :0071673 and positive regulation of smooth muscle cell chemotaxis and biological process this GO :0090026 and positive regulation of monocyte chemotaxis and biological process this GO :0097178 and ruffle assembly and biological process this GO :1900087 and positive regulation of G1/S transition of mitotic cell cycle and biological process this GO :2000406 and positive regulation of T cell migration and biological process, nuclei, this GO :0001726 and ruffle and cellular component this GO :0001774 and microglial cell activation and biological process this GO :0001891 and pha this GO cytic cup and cellular component this GO :0001934 and positive regulation of protein phosphorylation and biological process this GO :0003674 and molecular function and molecular function this GO :0005509 and calcium ion binding and molecular function this GO :0005515 and protein binding and molecular function this GO :0005634 and nucleus and cellular component this GO :0005737 and cytoplasm and cellular component this GO :0005829 and cytosol and cellular component this GO :0005884 and actin filament and cellular component this GO :0006911 and pha this GO cytosis, this GO :0003674 : molecular_function, this GO :0003674 : molecular_function and also this GO :0005509 : calcium ion binding and also this GO :0005515 : protein binding and also this GO :0051015 : actin filament binding, this GO :0005509 : calcium ion binding, this GO :0005515 : protein binding, this GO :0051015 : actin filament binding, allograft inflammatory factor 1 |
| Identity: |
352 |
| Gene: |
AIF1 |
More about : AIF1 |
| Long gene name: |
allograft inflammatory factor 1 |
| Synonyms: |
IRT-1 AIF-1 Em:AF129756, 17 IBA1 |
| Synonyms name: |
interferon gamma responsive transcript ionized calcium-binding adapter molecule 1 |
| Locus: |
6p21, 33 |
| Discovery year: |
1997-07-01 |
| GenBank acession: |
U19713 |
| Entrez gene record: |
199 |
| Pubmed identfication: |
8912632 |
| Classification: |
EF-hand domain containing |
| Havana BLAST/BLAT: |
OTTHUMG00000031246 |