Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST)

Contact us
Catalog number: CF30
Price: 260 €
Supplier: adi
Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST)
Quantity: 10 μg
Other quantities: 1 mg 1674€ 10 µg 95€ 50 µg 156€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 4 kD, 44
UniProt number: P63279
State of the product: Liquid
Shipping conditions: Dry Ice/ice packs
Formulation: 150 mM sodium chloride, pH 7, 2 um filtered solution of 50 mM HEPES, 5, Supplied as a 0
Storage recommendations: -20°, Please minimize freeze-thaw cycles, stable for 6 months after receipt, C, Store at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSHMSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNWECAIPGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UBE2I (N-GST), Ubiquitin-Conjugating E2 I
Short name: UBE2I (N-GST), Recombinant Ubiquitin-Conjugating Enzyme E2 I
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UBE2I (N-GST), sapiens Ubiquitin-Conjugating Enzyme E2 I, recombinant H
Alternative technique: rec
Identity: 12485
Gene: UBE2I | More about : UBE2I
Long gene name: ubiquitin conjugating enzyme E2 I
Synonyms gene name: ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9) ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast) ubiquitin-conjugating enzyme E2I
Synonyms: UBC9
Locus: 16p13, 3
Discovery year: 1995-07-11
GenBank acession: D45050
Entrez gene record: 7329
Pubmed identfication: 8565643
RefSeq identity: NM_003345
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000186701

Related Products :

MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
CF30 Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST) 1 mg 1674 € novo human
MBS617434 Ubiquitin Conjugating Enzyme E2L3 (UBE2L3, ubiquitin-conjugating enzyme E2L 3, UBCH7) Antibody 100ug 591 € MBS Polyclonals_1 human
DL-UBE2I-Hu Human Ubiquitin Conjugating Enzyme E2I UBE2I ELISA Kit 96T 904 € DL elisas human
EKU08019 Ubiquitin Conjugating Enzyme E2I (UBE2I) ELISA kit 1 plate of 96 wells 822 € Biomatik ELISA kits human
MBS619190 Ubc9 (Ubiquitin Carrier Protein 9, Ubiquitin Conjugating Enzyme 9, UBC 9, UBC9 Homolog, UBC-9, UBCE9, C358B7.1, Homologous to Yeast UBC9, p18, SUMO Conjugating Enzyme UBC9, SUMO Protein Ligase, SUMO-1 Conjugating Enzyme, SUMO-1-protein Ligase, SUMO1 Conju 100ug 735 € MBS Polyclonals_1 yeast
C183 Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His) 10 µg 80 € novo human
CH56 Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST) 10 µg 75 € novo human
C184 Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4, UBE2D4 (N-GST) 1 mg 963 € novo human
CE09 Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2, UBE2G2, UBC7 (N-GST) 1 mg 557 € novo human
C185 Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, UBE2H (N-GST) 1 mg 963 € novo human
CE31 Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, UBE2J2 (N-GST) 1 mg 2283 € novo human
C186 Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-GST) 10 µg 80 € novo human
C289 Recombinant Human Ubiquitin-Conjugating Enzyme E2 S, UBE2S (N-GST) 50 µg 131 € novo human
MBS612110 RAD6 (Rad-6, BHR6A, hHR6A, HR6A, mHR6A, RAD6A, RAD6B, UBC-1, UBC2, UBC6, UBCD6, UBE2B, Ubiquitin Carrier Protein, Ubiquitin-conjugating Enzyme E2 A, UBE2A, Ubiquitin-conjugating Enzyme E2-17kD, Ubiquitin-conjugating enzyme E2-21.5kD, Ubiquitin-protein Lig Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human
MBS624307 UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) Antibody 100ug 658 € MBS Polyclonals_1 human
GENTAUR-58bcdb8e8b0e6 Xenopus laevis SUMO-conjugating enzyme UBC9 (ube2i) 100ug 1520 € MBS Recombinant Proteins xenopus
GENTAUR-58bcdb8ed2ec0 Xenopus laevis SUMO-conjugating enzyme UBC9 (ube2i) 1000ug 1520 € MBS Recombinant Proteins xenopus
GENTAUR-58bcdb8f277ca Xenopus laevis SUMO-conjugating enzyme UBC9 (ube2i) 100ug 2022 € MBS Recombinant Proteins xenopus
GENTAUR-58bcdb8f6f5db Xenopus laevis SUMO-conjugating enzyme UBC9 (ube2i) 1000ug 2022 € MBS Recombinant Proteins xenopus
MBS621243 USP11 (Ubiquitin Specific Peptidase 11, Ubiquitin Specific Protease 11, Ubiquitin Specific-processing Protease 11, Deubiquitinating Enzyme 11, Ubiquitin Carboxyl-terminal Hydrolase X-linked, Ubiquitin Thiolesterase 11, UHX1) 100ug 735 € MBS Polyclonals_1 human
GWB-P0020G Ubc9 (Human ubiquitin conjugating enzyme 9) Human, Recombinant Protein bulk Ask price € genways bulk human
RP-427 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 10 10 μg 260 € adi human
RP-426 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 12 10 μg 260 € adi human
RP-428 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 3 10 μg 260 € adi human
RP-425 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 7, His-tag 10 μg 260 € adi human
RP-421 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating Enzyme E2B 10 μg 260 € adi human