Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST)

Contact us
Catalog number: CH56
Price: 260 €
Supplier: adi
Product name: Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST)
Quantity: 10 μg
Other quantities: 1 mg 557€ 50 µg 136€ 500 µg 405€
Related search:

More details :

Reacts with: Human
Source: proteins, Recombinants or rec
Description: Activating enzymes will cut off the domain that is biological active to become functional, If the substrate is DNA they are called restriction enzymes, Enzymes are cleaving the substrate
Molecular Weight: 42, 9 kD
UniProt number: P51668
State of the product: Freeze-dried
Shipping conditions: Ambient temperature
Formulation: 10% Glycerin pH7, 2 um filtered solution of 50 mM HEPES,150 mM sodium chloride,2 mM DTT, 5, Lyophilized from a 0
Storage recommendations: -20°, Aliquots of reconstituted samples are stable at less -20°, If kept at at room temperature, If kept at at room temperature, Reconstituted protein solution should be stored at 4-7°, it is stable for 3 weeks, it is stable for 3 weeks, C, C for 2-7 days, C for 3 months, Freeze-dried proteins should be stored frozen at <
Reconstitution: Dissolve the lyophilized protein in ddH2O, Do not mix by vortex or pipetting, It is not recommended to reconstitute to a concentration less than 100 &mu, Please aliquot the reconstituted solution to minimize freeze-thaw cycles, Always centrifuge tubes before opening, g/ml
Purity: and determined by Polyacrylamide gel electrophoresis, Greater than 95%
Sequence of the amino acid: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM
Levels of endotoxin: 11 IEU/ug, LAL test shows less than than 0
Properties: Depending on the epitopes used human ELISA kits can be cross reactive to many other species, Mainly analyzed are human serum, Modern , cDNA and human recombinants are used in human reactive ELISA kits and to produce anti-human mono and polyclonal antibodies, human cell culture supernatants and biological samples, plasma, primarily , saliva, urine,  , (Homo sapiens, Homo sapiens sapiens), Human proteins, humans , ssp
Group: recombinants
Gene target: UBE2D1, UbcH5a (N-GST), Ubiquitin-Conjugating E2 D1
Short name: UBE2D1, UbcH5a (N-GST), Recombinant Ubiquitin-Conjugating Enzyme E2 D1
Technique: E, coli recombinant proteins are , enzymes, novo advises they will be reconstituted in a buffer soluion or culture medium for cell culture, supplied as white sterile powder lyopillized, Recombinant, genetic recombinations , in Escherichia coli
Species: Humans, Human
Alternative name: UBE2D1, UbcH5a (N-GST), sapiens Ubiquitin-Conjugating Enzyme E2 D1, recombinant H
Alternative technique: rec
Identity: 12474
Gene: UBE2D1 | More about : UBE2D1
Long gene name: ubiquitin conjugating enzyme E2 D1
Synonyms gene: SFT
Synonyms gene name: stimulator of Fe transport ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast) ubiquitin-conjugating enzyme E2D 1
Synonyms: UbcH5A UBCH5 UBC4/5 E2(17)KB1
Locus: 10q21, 1
Discovery year: 1997-03-21
GenBank acession: BC015997
Entrez gene record: 7321
Pubmed identfication: 10072594 8530467
RefSeq identity: NM_003338
Classification: Ubiquitin conjugating enzymes E2
Havana BLAST/BLAT: OTTHUMG00000018269

Related Products :

CH56 Recombinant Human Ubiquitin-Conjugating Enzyme E2 D1, UBE2D1, UbcH5a (N-GST) 10 µg 75 € novo human
MBS620751 Ubiquitin Conjugating Enzyme E2N (Ubiquitin-conjugating Enzyme E2 N, Ubiquitin-conjugating Enzyme E2N (Homologous to Yeast UBC13), Ubiquitin-conjugating Enzyme E2N (UBC13 Homolog Yeast), Ube2N, Bendless-like Ubiquitin Conjugating Enzyme, BLU, MGC131857, M 100ug 558 € MBS Polyclonals_1 yeast
MBS620173 UbcH7 (E2-F1, L-UBC, UbcH7, UbcM4, Ubiquitin Carrier Protein L3, Ubiquitin-conjugating Enzyme E2 L3, Ubiquitin-conjugating Enzyme E2-L3, Ube2L3, Ubiquitin-protein Ligase L3) 100ug 735 € MBS Polyclonals_1 human
GWB-22F0FC UbcH5a (UBE2D1) Active Human recombinant protein 1 x 1 vial 458 € genways human
MBS614179 UBE2I (UBE2I, ubiquitin-conjugating enzyme E2I (UBC9 homolog, yeast), C358B7.1, P18, UBC9, SUMO-1-protein ligase, ubiquitin carrier protein, ubiquitin conjugating enzyme 9, ubiquitin-conjugating enzyme E2I (homologous to yeast UBC9), ubiquitin-conjugating Antibody 100ug 591 € MBS Polyclonals_1 human
MBS617434 Ubiquitin Conjugating Enzyme E2L3 (UBE2L3, ubiquitin-conjugating enzyme E2L 3, UBCH7) Antibody 100ug 591 € MBS Polyclonals_1 human
GENTAUR-58b906a9da454 Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 100ug 1487 € MBS Recombinant Proteins rat
GENTAUR-58b906aa5441d Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 1000ug 1487 € MBS Recombinant Proteins rat
GENTAUR-58b906aab4ed3 Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 100ug 1989 € MBS Recombinant Proteins rat
GENTAUR-58b906ab25761 Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 1000ug 1989 € MBS Recombinant Proteins rat
GENTAUR-58ba0e5e304ec Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 100ug 1487 € MBS Recombinant Proteins rat
GENTAUR-58ba0e5edbd17 Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 1000ug 1487 € MBS Recombinant Proteins rat
GENTAUR-58ba0e5f8a7cc Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 100ug 1989 € MBS Recombinant Proteins rat
GENTAUR-58ba0e6035b51 Rat Ubiquitin-conjugating enzyme E2 D1 (Ube2d1) 1000ug 1989 € MBS Recombinant Proteins rat
MBS619190 Ubc9 (Ubiquitin Carrier Protein 9, Ubiquitin Conjugating Enzyme 9, UBC 9, UBC9 Homolog, UBC-9, UBCE9, C358B7.1, Homologous to Yeast UBC9, p18, SUMO Conjugating Enzyme UBC9, SUMO Protein Ligase, SUMO-1 Conjugating Enzyme, SUMO-1-protein Ligase, SUMO1 Conju 100ug 735 € MBS Polyclonals_1 yeast
C183 Recombinant Human Ubiquitin-Conjugating Enzyme E2 A, UBE2A (N-GST, 6His) 10 µg 80 € novo human
C184 Recombinant Human Ubiquitin-Conjugating Enzyme E2 D4, UBE2D4 (N-GST) 1 mg 963 € novo human
CE09 Recombinant Human Ubiquitin-Conjugating Enzyme E2 G2, UBE2G2, UBC7 (N-GST) 1 mg 557 € novo human
C185 Recombinant Human Ubiquitin-Conjugating Enzyme E2 H, UBE2H (N-GST) 1 mg 963 € novo human
CF30 Recombinant Human Ubiquitin-Conjugating Enzyme E2 I, UBE2I (N-GST) 1 mg 1674 € novo human
CE31 Recombinant Human Ubiquitin-Conjugating Enzyme E2 J2, UBE2J2 (N-GST) 1 mg 2283 € novo human
C186 Recombinant Human Ubiquitin-Conjugating Enzyme E2 K, UBE2K (N-GST) 10 µg 80 € novo human
C289 Recombinant Human Ubiquitin-Conjugating Enzyme E2 S, UBE2S (N-GST) 50 µg 131 € novo human
MBS612110 RAD6 (Rad-6, BHR6A, hHR6A, HR6A, mHR6A, RAD6A, RAD6B, UBC-1, UBC2, UBC6, UBCD6, UBE2B, Ubiquitin Carrier Protein, Ubiquitin-conjugating Enzyme E2 A, UBE2A, Ubiquitin-conjugating Enzyme E2-17kD, Ubiquitin-conjugating enzyme E2-21.5kD, Ubiquitin-protein Lig Antibody 100ul 785 € MBS Polyclonals_1 human
MBS623756 UBE2G2, NT (Ubiquitin-conjugating Enzyme E2 G2, Ubiquitin-protein Ligase G2, Ubiquitin Carrier Protein G2) 200ul 603 € MBS Polyclonals_1 human
MBS624307 UBE2Q2 (Ubiquitin-conjugating Enzyme E2 Q2, Ubiquitin Carrier Protein Q2, Ubiquitin-protein Ligase Q2) Antibody 100ug 658 € MBS Polyclonals_1 human
MBS621243 USP11 (Ubiquitin Specific Peptidase 11, Ubiquitin Specific Protease 11, Ubiquitin Specific-processing Protease 11, Deubiquitinating Enzyme 11, Ubiquitin Carboxyl-terminal Hydrolase X-linked, Ubiquitin Thiolesterase 11, UHX1) 100ug 735 € MBS Polyclonals_1 human
GWB-P0020G Ubc9 (Human ubiquitin conjugating enzyme 9) Human, Recombinant Protein bulk Ask price € genways bulk human
RP-427 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 10 10 μg 260 € adi human
RP-426 Recombinant (E.Coli, His-tag) Human Ubiquitin Conjugating enzyme 12 10 μg 260 € adi human